KEGG   Desulfobacula toluolica: TOL2_C03790Help
Entry
TOL2_C03790       CDS       T02268                                 

Gene name
bamB1
Definition
(RefSeq) aldehyde:ferredoxin oxidoreductase BamB1 (EC:1.2.7.5)
  KO
K19515  
benzoyl-CoA reductase subunit BamB [EC:1.3.-.-]
Organism
dto  Desulfobacula toluolica
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Module
Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TOL2_C03790 (bamB1)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.-  Acting on the CH-CH group of donors
    1.3.-.-  
     TOL2_C03790 (bamB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(458355..460361)
Genome map
AA seq 668 aa AA seqDB search
MRYAETGFNLEVDLTRGNIEKVATDPRDTELYLGGLGTNAKILWDRVPPEVEPFSPENLL
IFGAGLLCGTPATGCNRTILTTISPQTKLMAFSMMGGFWAPELKYAGYDKVILRGKSPDL
VYLWINNDKVEIRDASHLHGKGAIETAEIIKKELNEPKAQVAAIGLAGENRVYYASVEQG
RSSASRGGIGAVMGDKGVKAIVVRGTKDINLSQPAEFMELCNGVLEYIKHRDGNPIPGVM
PILAGLGSPQEMKVHDEKWHTENFMWGNSRTRRKGFWTEEVESSWTETLENARTRLISCF
NCPMKCGATLSLPGLPTYMMKCFTKLTYTMGAFSDLDFGLRIAQKATEYGLDGFSTPQVM
AFGLELLENGILSEDDFPGLPEDNEGKFYYLLDKIVNREGIGDILANGTYWAAKEIGNGA
EEYAHNNIKKHEQLPLKLSMLNPIYFLMYCTGEKMNITQIEGQFPQAPFPKKEHREKFCE
DWIQVPHEKFKQYFIDWELRGENSLPFYPTVEMTCDIVDWQERMHYIDDALGQCAGLSSF
PLKPPYHIHNYPKFISAGAGIEMDEEKLTAAATRYRTLVRAFNIRRGMRRKDEKPPEDHW
KKRFPELEKELLDSYYKLKGWNNDGIPTKEFLNKMGLDYVAEEFIERGILTDAEDAPLEE
SSVEKENN
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgcagagacagggtttaatttagaggttgatctaacccgaggaaatattgaa
aaagtcgcaaccgacccaagagatacagagctttatcttgggggattaggtactaacgcc
aagatattatgggatagggttccccctgaggttgaacctttttctcctgaaaatttatta
atttttggtgccggccttttgtgcgggacacctgcgaccggttgtaatcgtaccattctt
acgaccatttcgcctcaaaccaaattaatggcattttcaatgatgggaggattttgggca
ccggaattaaaatatgccggttatgataaagtaatccttcgcggcaaatctccagacctg
gtctatttgtggatcaacaatgacaaggtggaaatacgggatgcatctcatctgcacgga
aaaggtgctattgaaacagctgaaatcattaaaaaagaactcaacgagcccaaagctcag
gtggccgctatcgggcttgccggtgaaaacagggtgtattatgcttctgtcgagcagggc
agatccagtgcaagtcgaggtggcataggggctgtcatgggtgacaaaggcgtaaaagcc
attgttgtccggggaacaaaggatatcaacctttcccagcctgctgaatttatggaactt
tgtaacggcgttctggagtacatcaaacaccgggacggaaacccgatccctggagttatg
ccaatccttgccggacttggatctccccaggaaatgaaagttcatgatgaaaaatggcac
actgaaaatttcatgtggggaaattcccgtacccgtcgaaaaggattctggactgaagaa
gtcgagtcaagctggacggaaaccctggaaaatgccaggacaaggctgatttcctgcttt
aattgccccatgaaatgcggtgcaacactttctttgccgggacttccgacctacatgatg
aaatgcttcacaaagttaacttatacaatgggtgctttttcagatttggattttggttta
cgaatcgctcaaaaagctacagagtatggattggacggattttcaactccacaggtcatg
gcctttggtcttgaacttctggaaaacggtattttaagtgaggatgactttccaggactt
ccggaagacaatgagggcaaattttattatctgcttgacaaaattgtcaatcgtgaagga
atcggagatattttggccaatggtacttattgggcagccaaagagatcggcaatggtgcg
gaagaatatgcacacaataatatcaaaaaacacgaacaactgccgctcaaactgtccatg
ctcaatccgatctattttcttatgtattgtaccggcgaaaaaatgaacattactcagatt
gaaggccagttccctcaagcgccttttcccaaaaaagaacacagagaaaaattttgtgag
gactggattcaggttccccatgaaaaattcaagcaatattttatcgactgggaattgcgc
ggagaaaactcacttccattctatccaacagttgaaatgacctgtgatattgttgactgg
caagaaagaatgcactacattgatgatgctttgggccaatgtgcaggtctgtcatccttt
cctttaaaaccgccgtatcacatccacaattatcctaaatttatttcagccggtgccgga
attgaaatggatgaggaaaaattgacagcagccgccacaagatatcgaaccttagtcaga
gcctttaatataagacgaggcatgagaagaaaagatgaaaaaccgcctgaagatcactgg
aagaaaagatttcccgaacttgaaaaggaactcttggacagttattacaaactcaaaggg
tggaacaatgacggtattccgactaaagaattcttgaataaaatgggtttggactatgtg
gctgaggaatttatagagcggggaatcttaacggatgctgaagacgctcctttagaagag
tcatcagttgaaaaagagaataattag

DBGET integrated database retrieval system