KEGG   Desulfobacula toluolica: TOL2_C05220Help
Entry
TOL2_C05220       CDS       T02268                                 

Gene name
acsA
Definition
(GenBank) AcsA: acetyl-coenzyme A synthetase (acetate--CoA ligase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dto  Desulfobacula toluolica
Pathway
dto00010  Glycolysis / Gluconeogenesis
dto00620  Pyruvate metabolism
dto00640  Propanoate metabolism
dto00680  Methane metabolism
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01120  Microbial metabolism in diverse environments
dto01130  Biosynthesis of antibiotics
dto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C05220 (acsA)
   00620 Pyruvate metabolism
    TOL2_C05220 (acsA)
   00640 Propanoate metabolism
    TOL2_C05220 (acsA)
  Energy metabolism
   00680 Methane metabolism
    TOL2_C05220 (acsA)
Enzymes [BR:dto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TOL2_C05220 (acsA)
Lipid biosynthesis proteins [BR:dto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TOL2_C05220 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCK78690
UniProt: K0ND50
Position
623949..625916
Genome map
AA seq 655 aa AA seqDB search
MSEFKFHAPDEYRKNAWIKTMDEYKQMYDQSIEKPEEFWTQMADQFYWEKRWDSVRDYNY
SISKGPINIEWFKGGKTNITYNCLDRHLKDRGDQTALIWEGNSIGEDREISYKELYEMVC
QFANVLKSKGVQKGDRVAIYMPMIPELAVTMLACARIGAIHSIVFGGFSADALSNRILDS
LCKVLVTSDGVMRGAKAVPLKGNADTAMDLCEKQGHLVECCVVVNRTGSEVEMKQGRDVW
WHEQIQAQSMDCPVEWMDAEDPLFILYTSGSTGTPKGVQHNVGGYMVYTGITFRYIFDYH
DNDIYWCTADIGWVTGHSYIVYGPLSQGATSIMFEGVPNYPDPGRFWATVDKWKVNQFYT
APTAIRALMAQGEQWVEKYDLSSLRLLGSVGEPINPEAWKWYFKHVGKERCPIVDTWWQT
ETGGIMITALPYAIDQKPGSATLPFFGVNPVLLNEEGKPLEGACDGILAIQEPWPGQMRT
VYNNHERFEKVYFQMFDGYYFAGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEVESAL
VSHKEVAEAAVIGFPHDIKGQGIYAFVTLNVSATPSDELLSQLKLHVRKEIGPIATPDII
HFAPALPKTRSGKIMRRILRKIATDEFDSLGDISTLADPEVVGSLIENHKELTSN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatttaaatttcacgcacctgatgagtaccgtaaaaatgcctggatcaaaaca
atggatgagtacaaacagatgtatgatcagtctattgagaaaccagaagaattttggaca
caaatggcggatcagttctactgggaaaaacgctgggacagtgtccgggattataactac
agcatttccaaaggccctattaatattgagtggttcaagggcggcaaaacaaatattact
tacaattgccttgaccgtcatttaaaagacaggggcgatcaaaccgccttgatatgggaa
ggaaacagtattggcgaagaccgtgaaatttcctacaaagaactctatgaaatggtttgt
caatttgccaatgttttaaaatccaaaggcgtacaaaaaggcgaccgggtagccatttac
atgcccatgataccggagcttgccgtcaccatgctggcatgtgccagaatcggtgccatt
cacagtattgtttttggcggtttttccgcagacgccttgtctaaccgtatactggacagc
ctttgtaaagttcttgttacctctgatggtgttatgcggggggctaaggctgttccgtta
aaaggcaatgcagatacggctatggatctgtgtgagaaacaggggcatttggtggagtgc
tgtgttgtggtcaatcgaaccggttccgaggttgaaatgaaacagggcagggatgtgtgg
tggcatgagcagatccaggcgcaaagcatggattgtcccgtggaatggatggatgcagaa
gatcctttgtttatcctttacacctcaggatcaacaggaacgcccaaaggtgtgcaacac
aatgtaggcggctacatggtttataccggtatcactttcagatatatttttgactaccat
gacaacgacatctactggtgtactgctgatatcggctgggtaaccgggcacagctacatt
gtttacggtcccctctcacaaggtgccacaagcatcatgtttgagggggtccccaattat
cctgatcctggacggttctgggccacagtggataaatggaaggtaaaccagttttacaca
gctcccacagccataagggcattgatggctcagggggagcaatgggttgaaaaatatgat
ctttcatctttaagattgttgggatcggttggcgaacccattaatcccgaggcctggaaa
tggtattttaaacatgtgggcaaagaaagatgcccgatcgtggatacctggtggcagact
gaaaccggaggcatcatgattacggctcttccctatgccattgaccagaaaccggggtca
gccaccctgccgtttttcggtgttaatccggtgctgttaaatgaagagggaaaacccctt
gaaggggcttgtgacggtatcctggccatacaagaaccatggcccggccagatgagaact
gtttacaataatcatgaaagatttgaaaaagtttattttcagatgtttgacggctattac
tttgccggtgacggatgccgcagggatgaagacggttattactggatcacaggacgtgtg
gatgatgtcatcaatgtgtccggccacaggatggggacggccgaggttgaaagcgccctg
gtcagtcataaggaggtggccgaagccgcagtgatcggctttccccatgacattaaaggt
cagggtatttatgcatttgtcaccctcaatgtcagtgcaaccccgagcgatgaattgtta
agccagctcaaactgcacgtcagaaaggagatcgggccaattgccacacctgatattatc
cattttgcacctgcattgcctaaaacccggtcaggcaaaattatgcgccggattttgcga
aaaatcgcaactgatgagtttgacagcttaggtgacatctccacccttgcagatcccgag
gtggtgggcagcctgatcgaaaaccataaggaattaacaagtaattaa

DBGET integrated database retrieval system