KEGG   Desulfobacula toluolica: TOL2_C05220Help
Entry
TOL2_C05220       CDS       T02268                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase AcsA (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dto  Desulfobacula toluolica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dto01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dto00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dto00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dto00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dto00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623949..625916
Genome map
AA seq 655 aa AA seqDB search
MSEFKFHAPDEYRKNAWIKTMDEYKQMYDQSIEKPEEFWTQMADQFYWEKRWDSVRDYNY
SISKGPINIEWFKGGKTNITYNCLDRHLKDRGDQTALIWEGNSIGEDREISYKELYEMVC
QFANVLKSKGVQKGDRVAIYMPMIPELAVTMLACARIGAIHSIVFGGFSADALSNRILDS
LCKVLVTSDGVMRGAKAVPLKGNADTAMDLCEKQGHLVECCVVVNRTGSEVEMKQGRDVW
WHEQIQAQSMDCPVEWMDAEDPLFILYTSGSTGTPKGVQHNVGGYMVYTGITFRYIFDYH
DNDIYWCTADIGWVTGHSYIVYGPLSQGATSIMFEGVPNYPDPGRFWATVDKWKVNQFYT
APTAIRALMAQGEQWVEKYDLSSLRLLGSVGEPINPEAWKWYFKHVGKERCPIVDTWWQT
ETGGIMITALPYAIDQKPGSATLPFFGVNPVLLNEEGKPLEGACDGILAIQEPWPGQMRT
VYNNHERFEKVYFQMFDGYYFAGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEVESAL
VSHKEVAEAAVIGFPHDIKGQGIYAFVTLNVSATPSDELLSQLKLHVRKEIGPIATPDII
HFAPALPKTRSGKIMRRILRKIATDEFDSLGDISTLADPEVVGSLIENHKELTSN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatttaaatttcacgcacctgatgagtaccgtaaaaatgcctggatcaaaaca
atggatgagtacaaacagatgtatgatcagtctattgagaaaccagaagaattttggaca
caaatggcggatcagttctactgggaaaaacgctgggacagtgtccgggattataactac
agcatttccaaaggccctattaatattgagtggttcaagggcggcaaaacaaatattact
tacaattgccttgaccgtcatttaaaagacaggggcgatcaaaccgccttgatatgggaa
ggaaacagtattggcgaagaccgtgaaatttcctacaaagaactctatgaaatggtttgt
caatttgccaatgttttaaaatccaaaggcgtacaaaaaggcgaccgggtagccatttac
atgcccatgataccggagcttgccgtcaccatgctggcatgtgccagaatcggtgccatt
cacagtattgtttttggcggtttttccgcagacgccttgtctaaccgtatactggacagc
ctttgtaaagttcttgttacctctgatggtgttatgcggggggctaaggctgttccgtta
aaaggcaatgcagatacggctatggatctgtgtgagaaacaggggcatttggtggagtgc
tgtgttgtggtcaatcgaaccggttccgaggttgaaatgaaacagggcagggatgtgtgg
tggcatgagcagatccaggcgcaaagcatggattgtcccgtggaatggatggatgcagaa
gatcctttgtttatcctttacacctcaggatcaacaggaacgcccaaaggtgtgcaacac
aatgtaggcggctacatggtttataccggtatcactttcagatatatttttgactaccat
gacaacgacatctactggtgtactgctgatatcggctgggtaaccgggcacagctacatt
gtttacggtcccctctcacaaggtgccacaagcatcatgtttgagggggtccccaattat
cctgatcctggacggttctgggccacagtggataaatggaaggtaaaccagttttacaca
gctcccacagccataagggcattgatggctcagggggagcaatgggttgaaaaatatgat
ctttcatctttaagattgttgggatcggttggcgaacccattaatcccgaggcctggaaa
tggtattttaaacatgtgggcaaagaaagatgcccgatcgtggatacctggtggcagact
gaaaccggaggcatcatgattacggctcttccctatgccattgaccagaaaccggggtca
gccaccctgccgtttttcggtgttaatccggtgctgttaaatgaagagggaaaacccctt
gaaggggcttgtgacggtatcctggccatacaagaaccatggcccggccagatgagaact
gtttacaataatcatgaaagatttgaaaaagtttattttcagatgtttgacggctattac
tttgccggtgacggatgccgcagggatgaagacggttattactggatcacaggacgtgtg
gatgatgtcatcaatgtgtccggccacaggatggggacggccgaggttgaaagcgccctg
gtcagtcataaggaggtggccgaagccgcagtgatcggctttccccatgacattaaaggt
cagggtatttatgcatttgtcaccctcaatgtcagtgcaaccccgagcgatgaattgtta
agccagctcaaactgcacgtcagaaaggagatcgggccaattgccacacctgatattatc
cattttgcacctgcattgcctaaaacccggtcaggcaaaattatgcgccggattttgcga
aaaatcgcaactgatgagtttgacagcttaggtgacatctccacccttgcagatcccgag
gtggtgggcagcctgatcgaaaaccataaggaattaacaagtaattaa

DBGET integrated database retrieval system