KEGG   Desulfobacula toluolica: TOL2_C05520Help
Entry
TOL2_C05520       CDS       T02268                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dto  Desulfobacula toluolica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TOL2_C05520 (galU)
   00052 Galactose metabolism
    TOL2_C05520 (galU)
   00500 Starch and sucrose metabolism
    TOL2_C05520 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TOL2_C05520 (galU)
Enzymes [BR:dto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TOL2_C05520 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(667676..668548)
Genome map
AA seq 290 aa AA seqDB search
MKIKKAVFPVAGLGTRFIPATKAMAKEMLTVVDKPIIQYAVEEAFEAGIEQIIFVTGRGK
KALEDHFDRSYEIEHALQEKGKDDLLKQIQELVPKTGNIIYTRQHQPLGLGHAILCAKDI
VGDEPFAVLLADDLIQTDKPVLSEMVKKFDRLRASMAAVMEVEKDQTDKYGILDAQQVEE
DIFRIDDMVEKPSPDQAPSNLAIIGRYILTPKIFEYLEKKEKGAGGEIQLTDAMKTLLKE
QPIYGYKFKGTRFDCGDKAGFQMANLSFALERPDLRDRLIKFIREIQKKY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaggctgtttttccggtagcaggacttggcacgagatttatccccgca
accaaagccatggctaaagagatgctcactgttgttgacaaacccatcatccagtatgcg
gttgaagaagcctttgaagccggtatcgaacagattatttttgttacgggccgtgggaaa
aaagcacttgaagaccattttgacaggtcttatgaaatagaacacgcactacaggaaaaa
ggcaaagacgatcttttaaaacaaatccaggaacttgttcccaaaacaggcaacattatt
tatacccgtcagcaccagcctttgggcctgggtcatgccatattgtgtgcaaaagatatt
gtcggagatgagccgtttgcagtacttctggctgatgaccttatccagaccgataaaccc
gttctttccgaaatggtaaaaaaattcgaccggttacgggcatccatggctgcggtcatg
gaagtggaaaaagaccagacagacaaatacggcatccttgatgcccaacaggtggaagaa
gatattttccgaatcgacgatatggtggaaaaaccaagtccggaccaagccccttccaac
cttgccattataggccgctatatcctcacccccaaaatttttgaatatttagaaaaaaaa
gaaaaaggcgcgggaggagaaatccagcttaccgatgccatgaaaacccttctcaaagaa
cagccgatctatggatataaatttaagggaacacgctttgactgtggagataaagcagga
ttccagatggccaacctttcatttgcccttgaaagaccggacctgagagacaggctgata
aaattcatacgagaaattcaaaaaaaatattag

DBGET integrated database retrieval system