KEGG   Desulfobacula toluolica: TOL2_C05910Help
Entry
TOL2_C05910       CDS       T02268                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dto  Desulfobacula toluolica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOL2_C05910 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOL2_C05910 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TOL2_C05910 (thrC)
Enzymes [BR:dto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TOL2_C05910 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(709543..711048)
Genome map
AA seq 501 aa AA seqDB search
MKLDFFPEDIRPHIIPETREGLYYKCLGCSAEYPIEKLLYVCPECNQVLLIQDRNAASLQ
KIPGAVWQKIFDFRKMLKIPALKGIYRYHEFIGPCIPLESIVYLGEGHTPIVEANQTLQK
KVGLSFFYKNDGQNPSASFKDRGMASAVSSIKYLIDQKLVSDVIAICASTGDTSAAASLY
ASYLDPLIKSAVLLPHKKVTSQQLSQPLGSGAHVFEIPGVFDDCMKIVEHLSTQYSVVLL
NSKNAWRILGQESYSYEIAQDFEWDMKDKVVVVPIGNAGNISAVMNGFIKFYEANIIDCL
PKIIGVQSEHADPVFQYYLEPDETKRKFVPVDTKPSVAQAAMIGNPVSMPRVVHIAKKYN
SLAGRQQVFFVQVTEQSIMDWQLLANKNGHITCTQGGECLAGLVKALDKKIVNKKDTAIL
DATAHAIKFSEFQDLYFNSKIPKDYHIDSDPDKINLPSLILPDNPNMVPSQKKRLGEKDF
QNFVKDISEKIAERLSLKVSL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgatttctttcctgaggatatacgacctcatatcataccagagacaagagaa
gggctgtattacaaatgccttggatgttctgccgaatatcccattgaaaaacttttgtat
gtttgccctgagtgtaatcaggtactgctcatccaggatcgaaatgccgcctccctacaa
aaaattccaggggctgtatggcaaaaaatatttgatttcagaaaaatgttgaaaatcccc
gcactcaagggaatttaccggtatcatgaatttatcggaccctgcatccctctggagtcc
attgtttaccttggcgaaggtcacacccccattgttgaagccaatcaaaccctgcaaaag
aaagtcgggctatcctttttttataaaaacgacggacaaaaccccagtgcatcttttaaa
gaccgtggtatggccagtgccgtgtcaagcatcaaatatctcatcgaccaaaaactggta
tcggatgttattgccatatgtgcctccacgggtgacacatctgctgcagcatcactctat
gcctcctatctggaccctttaatcaaatccgctgttcttttaccacacaaaaaggtaacg
tctcaacaattgtcacaaccactgggaagcggcgcgcatgtatttgaaattccaggtgtt
tttgacgactgcatgaaaattgtggaacatttgtcaacccagtattcagtggtgctttta
aattcaaaaaatgcctggcgcattttaggtcaagaatcttattcatatgaaattgcccaa
gattttgaatgggatatgaaagacaaagtggtggtggttcccattgggaatgcaggcaat
atttcagcggtaatgaacgggtttatcaaattttatgaagccaatatcattgactgcctg
ccaaaaattataggcgttcagtcagaacatgcagatcctgtttttcaatactaccttgaa
cctgatgagaccaaaagaaaatttgtacccgtggatacaaaaccaagcgtggcccaggcg
gccatgattggaaatccggtttcaatgccaagggttgtacacattgcaaaaaaatacaat
tcacttgccggtcgccaacaggtattctttgttcaggtaacagaacaatccatcatggat
tggcagcttctggccaataagaacggacatattacctgcacccagggtggagagtgcctt
gcaggacttgtgaaagcacttgacaaaaaaattgtcaacaaaaaagataccgccatcctt
gatgcaacagcacatgccattaaattttcagaatttcaggacctttattttaactcaaaa
attcccaaagattatcacattgattccgacccggataaaatcaatttgccgtctcttata
ttgcctgataatccgaatatggtgccatcgcaaaaaaaacgacttggagaaaaagatttt
caaaactttgtaaaagatatttcagagaaaattgccgaaagattgagtctaaaagtatct
ttatga

DBGET integrated database retrieval system