KEGG   Desulfobacula toluolica: TOL2_C05960Help
Entry
TOL2_C05960       CDS       T02268                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dto  Desulfobacula toluolica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715916..716572
Genome map
AA seq 218 aa AA seqDB search
MNDEPKKFVRWRREMVEKQIMSRGITDPLVLEAMRTVPRHLFVSEALVESAYGDFPLPIG
EGQTISQPYIIAEMTQSLKLKGHERVLEIGTGSGYQAAILAKIVYKVYTIERNNTLFLQT
RKLFDRLKYYNIVTRYSDGTQGWKQESPFDAIIVTAGGQQIPAPLIEQLAIGGRLIMPVG
SNFLQELLHLEKTEDGIKTTNLGACRFVRLIGQHGWDE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgaacctaaaaaatttgtccgctggcgtcgtgaaatggttgaaaaacagatt
atgtcacggggaataacagatccattggttcttgaggcaatgagaacagtgccaaggcat
ttgtttgtcagtgaagcccttgtcgaaagcgcatatggggatttcccgcttcccattgga
gaggggcagacaatttctcaaccctatattattgctgagatgactcagagtctcaagtta
aaaggccatgaaagagttcttgagatcggtacaggatcagggtatcaggctgccatcctg
gctaagatcgtctataaggtgtataccattgaaagaaacaataccttgtttttgcaaaca
agaaagctttttgacaggttgaaatactataatattgttaccagatatagcgacggaacc
cagggttggaaacaggaaagtccgtttgatgctattattgttactgccgggggccagcag
attcctgcaccgctgattgaacagcttgcaatcggggggcgtcttattatgccggtgggc
agtaattttttacaggaactgctacatcttgaaaagacagaagacggaataaaaacaaca
aaccttggtgcttgcagatttgtaagattgattggtcagcatggctgggatgagtag

DBGET integrated database retrieval system