KEGG   Desulfobacula toluolica: TOL2_C13400Help
Entry
TOL2_C13400       CDS       T02268                                 

Gene name
recR
Definition
recombination protein R RecR
Orthology
K06187  
recombination protein RecR
Organism
dto  Desulfobacula toluolica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dto03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1580488..1581084)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPILKLINSLSKLPGIGKKTAERLALHILHAPDHDVATLATDIIELKSSIRLCTVC
FALSDKDKCRVCADPLRDQTLICVVENPTDMGAIEKSNSFLGTYHILGGVLSPIDGIGPD
DIRIKELFKRADPRKVKEIILATKTNVEGESTASYILEKLKRTNIKITRIASGIPMGGDL
QYIDQLTMQKAMEKRYGF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcccgaaccaattttaaaattgatcaacagtttgtcaaagctgccgggtatt
ggaaaaaaaactgctgaaaggcttgcgcttcacattctccatgccccggatcatgatgtc
gcaactctggcaaccgatatcattgaactgaaaagcagcattcgactgtgtactgtttgc
tttgccctgagcgacaaagacaaatgccgggtatgcgcagatccgttaagggatcaaaca
ctgatttgtgttgtagagaatcccacggatatgggagcaatcgaaaaatcaaattctttt
ttggggacctatcatatattgggcggtgtactttctcccattgacggcataggcccggat
gacataaggatcaaagagttgtttaaaagagctgatccacgaaaggtaaaagagattatc
cttgcaactaaaaccaatgttgagggcgaatccacagcttcctatatccttgaaaagctt
aaaagaacaaacatcaaaatcacaagaattgcttcgggtatccccatggggggagattta
caatatattgaccagctgactatgcaaaaagcaatggaaaaacgatatggattctga

DBGET integrated database retrieval system