KEGG   Desulfobacula toluolica: TOL2_C13570Help
Entry
TOL2_C13570       CDS       T02268                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dto  Desulfobacula toluolica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dto00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TOL2_C13570 (ruvA)
Enzymes [BR:dto01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TOL2_C13570 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1595818..1596468
Genome map
AA seq 216 aa AA seqDB search
MIGYLEGTILQFESDGILLLVGSVGYEVLLNPQMVEKLMSREATDKMISLYIYYHQTERQ
PKPVLIGFESPDDKEFFQTFITVDAIGPMKAVKAMTRPSSDIARAIETKDVSFLTGLSGV
GQRTAEKIIATLHGKVKKFMLVTKDENQDKNQDKKEMKTESFAFEMLDIGRQVEDVLVEQ
LGHSPASAKRMVKEALEANDKISTPEELFDEIFGKN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatatctggaaggcactattttgcagtttgaatctgatggtatcctgctgctt
gtgggtagtgtgggatatgaggtgctgttgaatccccaaatggttgaaaagctgatgtcc
cgggaagctaccgataaaatgatttctctgtatatttattatcaccagacagagcgacag
ccaaaacctgttcttatcggttttgaatctcctgatgacaaagaattttttcaaacattt
attaccgtagatgctataggccccatgaaagccgtcaaagccatgactcggccgtccagt
gatattgcaagggctattgaaacaaaagatgtctcttttttaaccggcttaagtggtgtt
ggtcaacgaacagctgaaaaaattattgcaacccttcatggaaaagttaaaaaatttatg
ctggtaaccaaagatgaaaaccaggataaaaatcaggataaaaaagaaatgaagaccgaa
tcttttgcgtttgagatgctcgacattggtcggcaggttgaggatgttcttgttgaacag
ctggggcattcccctgcatctgcaaaaagaatggtcaaggaagccttagaagctaatgat
aaaatttcaacgccggaagaactttttgatgagatttttgggaaaaattag

DBGET integrated database retrieval system