KEGG   Desulfobacula toluolica: TOL2_C13570Help
Entry
TOL2_C13570       CDS       T02268                                 

Gene name
ruvA
Definition
(GenBank) RuvA: holliday junction ATP-dependent DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dto  Desulfobacula toluolica
Pathway
dto03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dto00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TOL2_C13570 (ruvA)
Enzymes [BR:dto01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TOL2_C13570 (ruvA)
DNA repair and recombination proteins [BR:dto03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TOL2_C13570 (ruvA)
    RecFOR pathway proteins
     TOL2_C13570 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 DUF177 DUF2634
Motif
Other DBs
NCBI-ProteinID: CCK79520
UniProt: K0NF07
Position
1595818..1596468
Genome map
AA seq 216 aa AA seqDB search
MIGYLEGTILQFESDGILLLVGSVGYEVLLNPQMVEKLMSREATDKMISLYIYYHQTERQ
PKPVLIGFESPDDKEFFQTFITVDAIGPMKAVKAMTRPSSDIARAIETKDVSFLTGLSGV
GQRTAEKIIATLHGKVKKFMLVTKDENQDKNQDKKEMKTESFAFEMLDIGRQVEDVLVEQ
LGHSPASAKRMVKEALEANDKISTPEELFDEIFGKN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatatctggaaggcactattttgcagtttgaatctgatggtatcctgctgctt
gtgggtagtgtgggatatgaggtgctgttgaatccccaaatggttgaaaagctgatgtcc
cgggaagctaccgataaaatgatttctctgtatatttattatcaccagacagagcgacag
ccaaaacctgttcttatcggttttgaatctcctgatgacaaagaattttttcaaacattt
attaccgtagatgctataggccccatgaaagccgtcaaagccatgactcggccgtccagt
gatattgcaagggctattgaaacaaaagatgtctcttttttaaccggcttaagtggtgtt
ggtcaacgaacagctgaaaaaattattgcaacccttcatggaaaagttaaaaaatttatg
ctggtaaccaaagatgaaaaccaggataaaaatcaggataaaaaagaaatgaagaccgaa
tcttttgcgtttgagatgctcgacattggtcggcaggttgaggatgttcttgttgaacag
ctggggcattcccctgcatctgcaaaaagaatggtcaaggaagccttagaagctaatgat
aaaatttcaacgccggaagaactttttgatgagatttttgggaaaaattag

DBGET integrated database retrieval system