KEGG   Desulfobacula toluolica: TOL2_C14730Help
Entry
TOL2_C14730       CDS       T02268                                 

Gene name
acsA3
Definition
acetyl-CoA synthetase AcsA3 (EC:6.2.1.1)
Organism
dto  Desulfobacula toluolica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741502..1743268)
Genome map
AA seq 588 aa AA seqDB search
MEMKKFYRAVMELNQMDDNEQKEKAAKAFFEKLNFMEFPEYFNWVEEVFDNIHVKERGEN
LALLWTDIVTKETKRYTYKEFSANGNKCLNYLRNAGVKQSDNMYMMVPIVPETWFATYAG
IKGGLVSVPTATTMTMRELQYRFETYEPDVIISDQSFTDLMDEALTVTGITPKTKIVLGT
KPGWTSYADIENESATAEAAKTKAHDLLFCFFTSGTTGLPKRVGHSATSYPVGHLSTSVM
IGVKPDDIHHNLSAPGWAKWAWSSFFVPLNVGAAATGFNFTTLDGNQYLEAIATNKVSTF
CAPPTAWRMFINMDISAYDLSCLRQSISAGEPLNPEVIIQWKKFTGTEIRDFYGQTESTA
MIGNPPWMTGKMRNGSFGYPSFMYDVALIDDEGNEILTPDEPGHIVVKLDKFKSKGLFTE
YIGSPEKMNQVFIDDYYYTGDRASFDADGYWWFVGRADDVIKSSDYRVGPFEVESALVEH
PAIGEAAVIGKPDPKRHQLVKAYVILNQGFEPTRELALDLFKHTIAILAKFKIPRIIEFV
PEVPKTISGKIRRIELREQELARLEDKEETSPNEYFYWDFPELSSKNK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaaaaattttacagagcggtcatggaactcaatcagatggatgacaatgaa
caaaaagaaaaggctgccaaagcattctttgaaaaattaaatttcatggagttccctgaa
tattttaattgggttgaagaagtttttgataatatacatgtcaaagaaagaggagaaaac
ctggcactgctctggacggatattgttacaaaagagacaaaacgctatacatacaaagaa
ttttcagcaaacggaaacaaatgccttaactatcttcgaaatgcaggcgtgaagcaaagc
gacaatatgtacatgatggttcccattgtccctgaaacatggtttgcaacttatgccggc
ataaaaggcgggcttgtttcagtgcctacggctacgaccatgaccatgagggaactgcaa
tacagatttgaaacctatgaaccggatgttatcatctctgatcagtcttttaccgattta
atggatgaggctttaaccgtaaccgggatcacccccaagacaaaaatcgtacttggcacc
aaaccgggatggactagttatgccgacattgaaaatgaatcagcaacagccgaggctgca
aaaaccaaagcccatgatcttttgttctgtttttttacttccggaaccacaggacttccc
aaacgggttggacacagtgcaacctcatatcctgtggggcatttgtccacatccgtaatg
atcggggttaaaccggatgatatccatcacaacctcagtgcgccaggatgggcaaaatgg
gcatggagcagtttttttgtccccctgaacgttggtgcggctgcaacagggtttaatttt
acaacccttgacggaaatcaatatctggaagccatagcaacaaacaaagtcagcacgttc
tgtgcgccgccaactgcctggagaatgttcattaatatggatatatcagcatatgatctg
tcctgtctgcgccagtccatcagtgcgggagaacccctcaatccagaggttatcatccag
tggaaaaaattcaccggcactgaaatccgtgatttttacggacagaccgaatctacggca
atgatcggcaatcccccctggatgacaggaaaaatgcgtaacggatcattcggatatccg
tcgtttatgtatgatgttgctctgattgatgatgaaggaaatgaaattttaacccctgac
gagcccggtcatattgttgtaaaactggataaattcaaatccaaaggcctgtttacagaa
tatattggaagccctgaaaaaatgaatcaggtgtttattgacgattattactataccggg
gaccgcgcctcatttgatgcagacgggtactggtggtttgtaggccgggcagacgatgtg
atcaagtcctcggactaccgtgtgggtccgtttgaggttgaaagcgccctggttgagcat
ccggccattggtgaggccgctgttatcggaaaacccgatccaaagaggcatcagcttgtt
aaagcctatgttatcctgaatcagggatttgagcctacaagggaactggccctggatctg
tttaaacataccattgcaattcttgccaaattcaaaattcccaggatcattgaatttgtt
ccggaggttcccaagaccatcagcggtaaaataagaagaatagagctaagagaacaggaa
ctcgcacgactggaagacaaagaagaaacaagccccaacgaatatttttactgggatttt
cccgagttaagttcaaaaaacaaataa

DBGET integrated database retrieval system