KEGG   Desulfobacula toluolica: TOL2_C17090Help
Entry
TOL2_C17090       CDS       T02268                                 

Gene name
recD
Definition
DNA helicase, RecD/TraA type RecD (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dto  Desulfobacula toluolica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dto00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TOL2_C17090 (recD)
Enzymes [BR:dto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TOL2_C17090 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2001477..2004020
Genome map
AA seq 847 aa AA seqDB search
MRQQAVNQAVNQTGVITEIIKGIVDRVTFHNPDNGWSILRVLPFNNPHGQETVIVHQTKV
FAGATMEFEGFWTIHPKYGRQFQATVAREKKPATAAALEKYLGSGLIKGVGPKTAKKIVM
YFDRQTLDIFEENIERLTEVPGIAQKKLDMISQAWTEHKSIREVMMFLQSHGISTLFAVR
IYKKYGDDAIKIVTQDPYRLANDFYGIGFFSADKVALSIGLEPDSRQRIMAGIKHALAAS
RNFGHCYLTASQIDEQVTALLQLDLSHKLMELLQDMEKETLLMVRDLVLENGTSERCYYS
KSLYFDELYVAKRIVDIGNPPQVEKARVERWISVYCEAKDICLSHEQAESVCGVVREKFS
ILTGGPGCGKTTATLVIVKLIEAMGLNVILAAPTGRAAQRMMDVIGKESKTIHRLLGWQG
GKFKKDEKTPLKTDFLIVDECSMLDINLTASLLKAVPETAQILFIGDSDQLPSVGAGNVL
KDIISSGKVPCFKLTKIFRQAQSSLIIKYAHQINKGKIPWIKSPFKSPEIWQDTSDCLFL
DSEEATKEQINFIARVKHFYGLTPPELENNLSDLSNQSNLSGESADADLFEFRVQEPVIP
YETEITIPKKFEHVDLQKVYAAQTRSEELLMVVKKVHPWSSLHYGICAVDVVKKLYQEWI
PKYYGNCEIQILSPMTRGSLGTVSLNKLIQETSNPYAEGKRQLKVGERIFRAGDRVIHRR
NNYDLGVFNGDIGVITEIDNVDLTCTVSFYPDNRQVHYRQNDIMELDLAYAITIHKSQGS
EFEIVIIPIVTQHFKMLFRNLIYTGITRAKKLAVFVGTRKALSMAVRNHDISQRQTALKQ
LLISLNQ
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcaggcagtcaaccaggcggtcaaccagacaggtgttatcactgagatcatc
aaagggattgttgatagggttacctttcacaatcctgataatggatggtccattctccgg
gtattgccgtttaataatccccatggacaggaaaccgttattgtgcatcaaacaaaagta
tttgccggtgctacaatggaatttgaagggttctggacgattcaccccaaatatggccgc
cagtttcaggcaacagttgccagggaaaaaaaacctgccacagctgctgcattggaaaaa
tatctgggttcagggttgataaaaggtgtcggacccaaaaccgctaaaaaaattgtcatg
tattttgacagacaaactcttgatatctttgaagaaaatatagaaagactcactgaggtt
ccaggcattgcccaaaaaaaactggatatgatcagtcaggcctggacagaacacaaatcc
attagggaagtgatgatgtttctacagtcccatggcatcagcactttgttcgcggtcagg
atctataaaaagtacggggatgacgcaataaagattgttactcaagatccttaccggctg
gcaaatgatttttacggaataggttttttttctgcagacaaggtggcgttgagtataggg
cttgaacctgacagccggcaacgcatcatggccggcatcaagcatgccctggctgcaagc
aggaatttcgggcattgttatttgacggcttcccagattgatgagcaggttacagcgtta
ctgcaattggatctgtcccataaactgatggagctgttgcaagatatggaaaaagaaacg
cttctcatggtcagggatcttgttttggaaaacggcaccagtgaacgatgctattattcg
aaatctttgtattttgatgaactctatgttgcaaaaagaattgttgatattggaaatcca
ccacaggttgaaaaggcaagggttgagcgttggatatctgtgtactgtgaagcaaaagat
atctgtttgagccatgagcaggcagagtcggtttgcggtgttgtgcgtgaaaaattttca
attcttacaggcgggccagggtgtggtaagaccactgccacccttgtcattgttaaatta
atcgaagccatggggttaaatgttattctggcagcaccgaccggcagagcggcccaaaga
atgatggatgttattggaaaagagtccaaaacaatccacaggctgctgggatggcagggc
ggaaaatttaaaaaagatgaaaaaacaccgcttaaaacagattttcttattgttgatgaa
tgttcaatgctggatatcaatttgacggcatcattgctcaaggctgttcctgaaaccgct
cagattttgttcattggagattccgaccagttgccctcagtgggtgcgggaaatgtttta
aaggacatcatttcatcaggcaaggtgccgtgttttaaactgacaaaaatatttcggcag
gctcaatcgtctttgatcatcaaatatgcccaccagatcaataaaggtaagataccctgg
attaaatcaccctttaaaagtcctgaaatctggcaggatacaagcgattgcctgtttctt
gattcggaggaggcaaccaaagagcagatcaattttattgcacgggtgaaacatttttat
gggttaacacctcctgaattggaaaacaacctgtccgatctgtccaatcaatccaatttg
tccggggaatccgctgatgccgacttgtttgagtttcgtgtccaagaacctgtgattccc
tatgaaacggaaataaccatccccaaaaaatttgagcatgtggatctgcaaaaagtgtat
gcagcccaaaccaggagtgaagaactgcttatggttgtaaaaaaagttcatccctggtca
tctctgcattacggcatttgtgcggttgatgttgttaaaaagctttatcaggaatggatt
cccaaatattatggcaattgtgaaattcagatcctttctcccatgacaagaggaagcctt
gggacagtcagtttaaacaaactgattcaggaaacttcaaatccatatgctgaaggcaaa
cggcagttaaaggttggagaaagaatttttagagcaggagaccgggttattcaccggcgc
aacaattatgatctgggggtttttaatggtgatattggcgttatcacagagattgacaat
gttgatttaacatgcacggtttctttttatcctgataaccggcaggttcattacaggcaa
aatgatattatggagcttgatctggcctatgccataaccatacataaatcccagggcagt
gaatttgaaattgttattatcccgattgtgacacagcattttaaaatgctttttcgaaat
ttgatttatacagggataaccagggcaaaaaaacttgccgtttttgtgggtacgcgaaaa
gccctgtcaatggctgtcagaaatcatgatatcagtcaaaggcaaacagccttgaagcaa
ttgttgatatcattgaaccagtga

DBGET integrated database retrieval system