KEGG   Desulfobacula toluolica: TOL2_C19050Help
Entry
TOL2_C19050       CDS       T02268                                 

Gene name
proB
Definition
glutamate 5-kinase (gamma-glutamyl kinase) ProB (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dto  Desulfobacula toluolica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOL2_C19050 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TOL2_C19050 (proB)
Enzymes [BR:dto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TOL2_C19050 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2226115..2227245
Genome map
AA seq 376 aa AA seqDB search
MPKQRLITARRVVVKLGSNVITAKNSLNLEVIESISRQISSLMDRGIEVILVSSGAMAAG
LRKMQMMRRPDEIPKRQAIAAIGQSGLMNAYEKSFSECDKKVAQILLTAEDLNNRKRYLN
ARNTLHTLMEWKVVPVINENDTIMVEEIKLGDNDNLAAMITLLMDADFLFILTDIDGLYD
KDPRQFSDAKLIPKVTTFEKEIEEYASHIPGTLGTGGMLSKIQAARKVTSSGIPMIVARG
NSQNVLLRLFDGEEHGTYFVPRKEKMASRKCWIAYALVPKGSLVIDQGAVSAVRKNGKSL
LPIGVLSVEGEFEQGAAVFFKTSDNEIIGTGLVNYRSFDINLIKGLKSSQIEACLGGKHY
DEIIHRDNLVLKKDCG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacaacgtttgattactgccagacgggtagttgtaaaattgggcagtaatgtt
attacagctaaaaacagtttgaatctggaggtgattgaatccatctccaggcagatcagc
agccttatggacagggggattgaggtgatcctggtttcatcaggtgccatggcggccgga
cttagaaaaatgcaaatgatgcgccgtccggatgagatccccaaacgtcaggccattgca
gccataggccagagcggactgatgaatgcctatgaaaaaagtttttctgaatgtgataaa
aaagtggctcagattctgttgaccgcggaagacctgaacaaccggaaacgttatctgaat
gcaagaaatacattgcatacactcatggagtggaaggttgtgcctgttatcaatgagaat
gacaccatcatggttgaagagataaaacttggggataatgacaatcttgccgccatgatc
accttgttaatggatgcggattttttgtttattttaaccgatattgatggattgtacgat
aaagatccaaggcaattttccgatgcaaagctgatcccaaaagttaccacatttgaaaaa
gagattgaagaatatgcaagtcatattcccggaacattgggcaccgggggaatgctcagt
aaaatacaggccgcccggaaagtcacttcctcgggaattcccatgatagtggccaggggc
aattcccaaaacgtactattgcgtttgtttgacggggaggaacatggcacatattttgtt
cccagaaaagaaaaaatggccagcaggaaatgctggattgcctatgcccttgtccccaaa
ggcagtcttgttattgatcaaggtgcggtaagtgcggtacgaaaaaatggaaaaagccta
ttgcccataggggttttatctgtggaaggggagtttgagcagggggccgcggtttttttt
aaaacttctgacaatgaaatcattggtacgggactggtcaactaccggtcgtttgatatc
aatttgataaaaggattaaaatcttcccagatagaagcctgtcttggcggcaaacattat
gatgaaattattcatcgggacaatctggtactcaagaaagattgcggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system