KEGG   Desulfobacula toluolica: TOL2_C22070Help
Entry
TOL2_C22070       CDS       T02268                                 

Gene name
tpiA
Definition
(GenBank) TpiA: triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dto  Desulfobacula toluolica
Pathway
dto00010  Glycolysis / Gluconeogenesis
dto00051  Fructose and mannose metabolism
dto00562  Inositol phosphate metabolism
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01120  Microbial metabolism in diverse environments
dto01130  Biosynthesis of antibiotics
dto01200  Carbon metabolism
dto01230  Biosynthesis of amino acids
Module
dto_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C22070 (tpiA)
   00051 Fructose and mannose metabolism
    TOL2_C22070 (tpiA)
   00562 Inositol phosphate metabolism
    TOL2_C22070 (tpiA)
Enzymes [BR:dto01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TOL2_C22070 (tpiA)
Exosome [BR:dto04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TOL2_C22070 (tpiA)
  Exosomal proteins of bladder cancer cells
   TOL2_C22070 (tpiA)
  Exosomal proteins of melanoma cells
   TOL2_C22070 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCK80368
UniProt: K0NKB1
Position
2570535..2571293
Genome map
AA seq 252 aa AA seqDB search
MSRTPFIAGNWKMYKTGPEAVETARILTQLCSNVQEIDVMIAPTFLSLPLVAASLEGSKV
KIGAQNLYFEKQGAFTGEVSADMIKAAGAEYVIIGHSERRQYFGETNALVCKKIKAAIEV
GLKPILCIGESENQRNKEKTFLTLDKQVSDGLKGFGLDELKDLVVAYEPVWAIGTGKTAT
VDQVKKVHQYLRSLLEKLFSKDFADQTRIVYGGSVKPENVKELMGIEDVDGALVGGASLD
ANIFINIINYDI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaacccctttcatagccggcaactggaaaatgtataaaaccggtccggaagct
gtagaaacagccaggatacttacacaactttgttcgaatgttcaagaaattgatgtcatg
attgcaccaacctttctttcgctgcccctggttgcagcatcccttgaaggcagtaaggta
aaaatcggggcacaaaacctttattttgaaaaacaaggcgctttcaccggtgaagtcagt
gcagatatgataaaagctgccggtgcggaatatgtcataatcgggcattccgaaagacgg
cagtatttcggtgaaaccaatgccttggtatgcaagaaaattaaagctgccattgaagtc
ggcctgaagccgattttatgtattggagaatcggaaaatcaaagaaataaagaaaaaaca
tttttgacacttgacaaacaggtgtcagatgggttaaaaggctttggtcttgatgagcta
aaagatttagttgttgcttatgaacctgtatgggctattggcactggaaagacagccaca
gtcgatcaggttaaaaaagttcaccagtacctacgttctttgcttgaaaaattattttca
aaggactttgctgatcaaacacgtatagtgtatggtggttcagtcaaaccggagaatgta
aaagagttaatgggtattgaggatgtagacggagctcttgttggtggagcaagccttgat
gcaaacatatttattaacattataaattatgacatttaa

DBGET integrated database retrieval system