KEGG   Desulfobacula toluolica: TOL2_C22110Help
Entry
TOL2_C22110       CDS       T02268                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase HemB (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dto  Desulfobacula toluolica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dto00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2574938..2575912
Genome map
AA seq 324 aa AA seqDB search
MLFPDFRGRRLRANKNFRRMIRETKLSCDDFILPLFAIEGKSVKKPIDSMPGHFQLSCDH
IVTAAKEACDAGVPAIILFGVPDKKDPLATRAYASDAIVQKAVQAVKEQVPDITVITDVC
LCAYTDHGHCGVVENGIIDNDASLDLLAKTALSHVQAGADMVAPSDMMDGRVGEIRQTLD
EEGFSHIPVMSYAVKYSSAFYGPFREAAESAPQFGDRKTYQMDPANSLEAIREATMDVEE
GADIIMVKPALSYLDIIYRLKEEIDLPIAAYNVSGEYSIIKAGEMMGWVNAKDLIMETLL
SIKRAGADLILTYSAIEAARELNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctttttcccgattttcgaggacgaagattaagagcaaataaaaattttcgacgcatg
ataagagaaacaaagctgtcctgcgatgattttattcttcctttatttgccattgaaggc
aagtccgtaaaaaaacccattgattcaatgccgggacattttcaactgtcgtgtgaccat
attgtcacggcagccaaagaagcatgtgacgcaggtgttcctgctattatattattcggt
gttccggataagaaagatcctttagccacccgggcatatgcgtccgacgccattgttcaa
aaagctgttcaagcggtaaaagaacaggttcctgatatcacggtgataactgatgtctgt
ctttgcgcctatacggatcacgggcattgcggggttgtggaaaacggaattattgataat
gatgcatcccttgatctgctggcaaaaaccgctttgtcccatgtccaggccggggcggac
atggttgcgccatctgacatgatggacggcagggtcggggagatcagacagacccttgat
gaagagggattttctcacattcccgtaatgtcctatgcagtcaaatacagttcggcattt
tacgggcctttcagggaagctgctgaatcagcgccacaatttggtgaccgcaaaacctat
cagatggacccggccaattctcttgaagccataagggaagccaccatggatgttgaggaa
ggtgcggacattatcatggtaaaacccgccctgtcctatcttgatattatctatcgttta
aaagaagaaattgatctgcctattgcggcatataatgtgagtggtgagtattcaatcatt
aaagccggagagatgatgggctgggtcaatgccaaggaccttattatggaaactctttta
tccataaaacgagccggtgcggatttgattttgacctattccgcaattgaagcggcaagg
gagttgaacaagtaa

DBGET integrated database retrieval system