KEGG   Desulfobacula toluolica: TOL2_C23250Help
Entry
TOL2_C23250       CDS       T02268                                 

Gene name
asnB
Definition
asparagine synthetase AsnB (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dto  Desulfobacula toluolica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dto00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710308..2712287)
Genome map
AA seq 659 aa AA seqDB search
MSQGIFGIIDFKQIIDQPGKLAATMGRFLNNSGSRKAVVSCKWDDHYILGMKRISEISIQ
QPGIVKNEDLQLIGLIHGEIHNYESLLQDIPEEAGQCSGDLDLALQLYRLHGKEFYRKFN
GLFSLAILDLKKRAFFLANDRFGMAHQIYWTNVDNRFYFATHLKTLLSCPEIHKEIDFEA
LNLFLKYSYVSSPWSMIKGIHKLSPGNILVCKNGTATQEPFWDFNVLKNTPDNLDDAVFT
YKELLKNSIARQLDTHGQVGILLSGGLDSSANVALASQCMDKKLKTFSVGFEDSAFDERP
YARIVADHFGTQHHEYSINGSEIEDLPALIWHLEEPYFELGLFLTYQGMAAARKETDVIL
GGEAADQIFGTGGFAGGLPLALRYILLKGHLLGAASWMAGSLKRRYFYEHDNLAFKFRLL
WNRVADLNDWFFYGYDEHELRQLHQNPLLAKTPRIFPDKQPTVVPDSFADLYRETQINQD
IKHFSNENLMVKSGRMADMLDLTLRESYLDTELTDFMVSVDYGFKRSGGLVDHLRRNIQT
KFLHRKAMEGLLPPEIMAKPKQGGFVPVMIFLENENLRKRIYMHLLNSDIIKACFNLDYI
KTLFGNYEQHLRKKVYWHNFHNSKANRILFLLTFDIWHHFYLSNDFLEVQPMPLSEYLR
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagggaatatttggaataatcgatttcaagcagatcattgatcagcctggaaaa
cttgcagccacgatgggcaggttccttaacaacagcggctcaagaaaagcagtggtctcc
tgcaaatgggatgatcattatatactcggaatgaaacgtatcagtgagatttcaattcag
cagcctggtattgtaaagaatgaagatcttcagttgatcggactcatccatggagaaatt
cataattatgagagtttgttgcaggatatcccagaggaggccgggcaatgcagcggcgat
ctggatttggctcttcaactctaccggttgcacgggaaagaattttacaggaaattcaac
ggattattttccctggcgatcctggacctgaagaagagggcattcttcctggcaaatgac
cgctttggtatggcccatcagatttactggacaaatgttgacaacagattttactttgca
acccacttgaaaacacttttaagctgtccggaaatccataaagaaatagacttcgaggcg
ttgaacctttttttgaagtattcttacgtatcgtcaccctggtcgatgatcaaaggaatt
cacaagctttctcccggaaacatccttgtctgtaaaaatggaacagccacccaggaacct
ttctgggattttaatgtcttgaaaaacacacccgataacctggatgatgctgttttcacc
tataaggaattattgaaaaattcaatcgcccgccagcttgacacccatgggcaagtaggt
atccttctcagcggggggcttgattcaagtgccaatgttgctttagcttcccagtgtatg
gataagaagctgaaaacattttccgttgggtttgaagattctgcatttgatgaacggcca
tatgcaaggattgtggcggatcatttcggtacccagcaccatgagtacagcatcaacggc
agcgaaattgaagatttgcctgctttaatctggcatcttgaagaaccgtatttcgaactg
gggctttttctaacctatcagggaatggcggctgcccggaaagaaactgatgtgatactc
ggcggagaagcagccgatcagatattcggtaccggtggatttgcgggagggttgccgctg
gcattgcgctatatccttttaaaaggtcatctgctcggggccgcgtcctggatggcagga
agtttgaagagaaggtatttttacgagcatgacaaccttgctttcaagttccgtctcctc
tggaaccgggttgccgatttgaatgactggtttttttacggttatgacgaacatgaactc
agacagcttcatcaaaaccctttgctggcgaaaacgccgagaatctttccggataagcag
ccgacagtcgttcctgattcgtttgccgacctttaccgtgaaacccagataaaccaggat
attaaacatttctccaatgaaaacctcatggtcaaatcaggccgcatggccgacatgctg
gatctgaccttacgtgaatcctatctggatacggaactgactgattttatggtttctgtt
gattatggtttcaagcggtccggcgggctggtcgatcatttaagaagaaacattcagacc
aagtttcttcatagaaaagcaatggaaggtcttttgcctcccgaaatcatggcaaaaccc
aagcagggcggctttgtgccggtaatgatatttcttgaaaatgagaatcttagaaagcgg
atatacatgcatctgctgaattcggacattataaaagcctgcttcaatctggattatata
aagactttgtttggaaactatgaacagcaccttaggaaaaaggtctattggcacaatttc
cataattccaaggccaaccgaatcctttttcttttgacctttgacatctggcaccatttt
tatttgagcaacgattttcttgaagttcagcccatgcctttgagtgaatacttgagatga

DBGET integrated database retrieval system