KEGG   Desulfobacula toluolica: TOL2_C24150Help
Entry
TOL2_C24150       CDS       T02268                                 

Gene name
pfk2
Definition
(GenBank) Pfk2: phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dto  Desulfobacula toluolica
Pathway
dto00010  Glycolysis / Gluconeogenesis
dto00030  Pentose phosphate pathway
dto00051  Fructose and mannose metabolism
dto00052  Galactose metabolism
dto00680  Methane metabolism
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01120  Microbial metabolism in diverse environments
dto01130  Biosynthesis of antibiotics
dto01200  Carbon metabolism
dto01230  Biosynthesis of amino acids
dto03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C24150 (pfk2)
   00030 Pentose phosphate pathway
    TOL2_C24150 (pfk2)
   00051 Fructose and mannose metabolism
    TOL2_C24150 (pfk2)
   00052 Galactose metabolism
    TOL2_C24150 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    TOL2_C24150 (pfk2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TOL2_C24150 (pfk2)
Enzymes [BR:dto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TOL2_C24150 (pfk2)
Protein phosphatases and associated proteins [BR:dto01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TOL2_C24150 (pfk2)
Messenger RNA biogenesis [BR:dto03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TOL2_C24150 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CCK80576
UniProt: K0NH72
Position
2820347..2821666
Genome map
AA seq 439 aa AA seqDB search
MKNFDFCTDIPTLGEAKIISPLKKHTKPGEPEKRFISDDARVIVDVQINRLESDLKKNSS
FDQAGPREKIYFDPSKLKCAIVTCGGLCPGLNDIIRSIVLELYHIYNVKTIYGIKHGLQG
FIPDFQHDVMNLNPDSVSGIQNTGGSILGSSRGTQDIGMIVDCLERMTIGILFMVGGDGT
LMASKRIVEEIEQRNLKISVIGIPKTIDNDIYLVSRSFGFDTAVDVATLAIKGAHNEAIA
YPNGIGLVKLMGRHSGFLAATAALAQQDANFVLIPEVDISLDGKNGFLQALENRILHRKH
AVVIVAEGAGQKLFDKQQKKFDPSGNIVLQDIGLFLKEKISQWFKAKNIPISLKYIDPSY
IIRSLPANANDSVFCGFLGRDAVHAGMAGKTKLLISFWNNHYVHVPMDAASGKRKNLDPQ
GKLWQSILEATGQDTFFTD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttgatttttgcacggatattcccactcttggagaagcaaaaattatatct
ccgcttaaaaagcataccaaaccgggtgaacctgaaaaaagatttatttcagatgatgca
agggtaattgttgacgtgcagataaatcgcctggaatctgatttaaaaaaaaacagcagc
tttgatcaggccgggccaagagaaaaaatatattttgatccaagcaagctcaaatgtgcc
attgtaacctgcggcggattatgtcctggattgaacgatattatccggtctattgtcctg
gaactttaccacatctataatgttaaaacgatttatggaatcaagcacggacttcaagga
tttattcctgattttcaacacgatgtaatgaacttgaatcctgattcagtatcaggaatt
cagaatactggaggatcaatattgggttcctcccggggaactcaggatatcggtatgatt
gtagattgtcttgaaagaatgactatcggcattctgttcatggtgggcggtgacgggaca
ttaatggcatcgaaaagaattgtagaagaaattgaacaaaggaatttaaagatatcggtt
ataggaattcccaaaacaattgataatgacatttacctggtatccagatcatttggattt
gatactgcggttgatgttgcaacccttgccatcaagggggcacacaacgaagcgattgca
taccccaatggaatcggtttggtaaaactcatgggcagacattccggattcctggctgca
acggctgcactggcccaacaggatgctaattttgttctcattcccgaggttgatatttcc
ctggatggaaaaaacggttttttacaggcccttgaaaatcgaatactccatcgaaaacat
gcggttgttattgtggccgagggtgcgggtcagaaattatttgataaacagcaaaaaaag
tttgatccttccggaaatattgttcttcaggatattggcctttttctcaaagaaaaaata
tcacaatggtttaaggcaaaaaacattcccatttcattaaaatatattgacccgagctat
atcatcagaagcctgcccgcaaatgccaatgacagtgttttttgcggttttctcggccgg
gacgcagttcacgccggaatggcaggaaaaaccaaattattgatcagtttctggaacaac
cattatgttcatgtaccaatggatgctgcatcaggaaagcgaaagaatcttgacccccag
ggaaaactctggcagtcgattctggaagcaactggccaggatactttttttaccgactga

DBGET integrated database retrieval system