KEGG   Desulfobacula toluolica: TOL2_C24150Help
Entry
TOL2_C24150       CDS       T02268                                 

Gene name
pfk2
Definition
phosphofructokinase Pfk2 (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dto  Desulfobacula toluolica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOL2_C24150 (pfk2)
   01230 Biosynthesis of amino acids
    TOL2_C24150 (pfk2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C24150 (pfk2)
   00030 Pentose phosphate pathway
    TOL2_C24150 (pfk2)
   00051 Fructose and mannose metabolism
    TOL2_C24150 (pfk2)
   00052 Galactose metabolism
    TOL2_C24150 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    TOL2_C24150 (pfk2)
Enzymes [BR:dto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TOL2_C24150 (pfk2)
Protein phosphatases and associated proteins [BR:dto01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TOL2_C24150 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2820347..2821666
Genome map
AA seq 439 aa AA seqDB search
MKNFDFCTDIPTLGEAKIISPLKKHTKPGEPEKRFISDDARVIVDVQINRLESDLKKNSS
FDQAGPREKIYFDPSKLKCAIVTCGGLCPGLNDIIRSIVLELYHIYNVKTIYGIKHGLQG
FIPDFQHDVMNLNPDSVSGIQNTGGSILGSSRGTQDIGMIVDCLERMTIGILFMVGGDGT
LMASKRIVEEIEQRNLKISVIGIPKTIDNDIYLVSRSFGFDTAVDVATLAIKGAHNEAIA
YPNGIGLVKLMGRHSGFLAATAALAQQDANFVLIPEVDISLDGKNGFLQALENRILHRKH
AVVIVAEGAGQKLFDKQQKKFDPSGNIVLQDIGLFLKEKISQWFKAKNIPISLKYIDPSY
IIRSLPANANDSVFCGFLGRDAVHAGMAGKTKLLISFWNNHYVHVPMDAASGKRKNLDPQ
GKLWQSILEATGQDTFFTD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttgatttttgcacggatattcccactcttggagaagcaaaaattatatct
ccgcttaaaaagcataccaaaccgggtgaacctgaaaaaagatttatttcagatgatgca
agggtaattgttgacgtgcagataaatcgcctggaatctgatttaaaaaaaaacagcagc
tttgatcaggccgggccaagagaaaaaatatattttgatccaagcaagctcaaatgtgcc
attgtaacctgcggcggattatgtcctggattgaacgatattatccggtctattgtcctg
gaactttaccacatctataatgttaaaacgatttatggaatcaagcacggacttcaagga
tttattcctgattttcaacacgatgtaatgaacttgaatcctgattcagtatcaggaatt
cagaatactggaggatcaatattgggttcctcccggggaactcaggatatcggtatgatt
gtagattgtcttgaaagaatgactatcggcattctgttcatggtgggcggtgacgggaca
ttaatggcatcgaaaagaattgtagaagaaattgaacaaaggaatttaaagatatcggtt
ataggaattcccaaaacaattgataatgacatttacctggtatccagatcatttggattt
gatactgcggttgatgttgcaacccttgccatcaagggggcacacaacgaagcgattgca
taccccaatggaatcggtttggtaaaactcatgggcagacattccggattcctggctgca
acggctgcactggcccaacaggatgctaattttgttctcattcccgaggttgatatttcc
ctggatggaaaaaacggttttttacaggcccttgaaaatcgaatactccatcgaaaacat
gcggttgttattgtggccgagggtgcgggtcagaaattatttgataaacagcaaaaaaag
tttgatccttccggaaatattgttcttcaggatattggcctttttctcaaagaaaaaata
tcacaatggtttaaggcaaaaaacattcccatttcattaaaatatattgacccgagctat
atcatcagaagcctgcccgcaaatgccaatgacagtgttttttgcggttttctcggccgg
gacgcagttcacgccggaatggcaggaaaaaccaaattattgatcagtttctggaacaac
cattatgttcatgtaccaatggatgctgcatcaggaaagcgaaagaatcttgacccccag
ggaaaactctggcagtcgattctggaagcaactggccaggatactttttttaccgactga

DBGET integrated database retrieval system