KEGG   Desulfobacula toluolica: TOL2_C24780Help
Entry
TOL2_C24780       CDS       T02268                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dto  Desulfobacula toluolica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TOL2_C24780 (glgB)
Enzymes [BR:dto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TOL2_C24780 (glgB)
Exosome [BR:dto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TOL2_C24780 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2898876..2900918)
Genome map
AA seq 680 aa AA seqDB search
MKKCLNGHLSSDTENFNDPGLVPYAATISSRRLRIKALEEKLKKENNGSLSYFANYHEMF
GLHFENENDSWVFREWAPNATEIYIVCEKTSWQTSKDFALERKENHLFERRFSKQTFSHK
DLFKLKVVWPGGEGERIPTAATRVVQDARTLIFTAQVWHPETHYQWKINRFLPPDEPLLI
YETHVGMALEDGRIGTYAEFEHHILPKIIDAGYNAIQVMAIQEHPYYASFGYHVSSFFAA
SSRFGTPEELKSLIDAAHKSGVRVLMDIIHSHAVNNEVEGIAKFDGTCYQFFHNGPKGYH
RQWDSMCFDYGKPEVLKFLLSNLKLWIEEYKIDGFRFDGITSMIFEDHGLGRAFTSYADY
YGDDVDVDALSYLTLANSLVHDIQPEFITIAEDVSGYPGLAAPLSKGGTGFDYRYAMGIA
DFWIKLLKEVKDEHWHLATLWHELTTKRKEEKTISYAESHDQALVGDKTLMMRLMGGHIY
TSMQKNNDSIETFRGVALHKMIRLITIATAGSGYLNFMGNEFGHPEWVDFPCERNNFSHH
YARRQWSLKYDPDLYFYSLSEFDQQMIKLVKTNDLFSCSDVRLLCVHEDDKVIAFERNNM
VFVFNFHPSLSFSDYMFDAPPGEYKLVFNSDDIRFGGKGRLKKDQHHFTLFDSDRFGKRN
LLSLYLPTRTAIVLKLKKRQ
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgcttaaacggccatttatcgtctgatacggaaaatttcaatgatccgggt
cttgttccctatgcagcaaccatatcgtcccggcgactacgcatcaaagcgctggaagag
aagttaaaaaaagaaaacaacggatctttaagttattttgcaaattatcatgagatgttc
gggttgcattttgaaaatgaaaatgattcttgggtattcagggaatgggcacccaatgca
actgaaatatatatagtttgtgaaaaaacatcctggcaaacaagtaaagactttgcgctt
gaaagaaaagaaaatcatctttttgaaagacgattttccaaacaaactttttcccacaaa
gatctttttaagctcaaagtggtctggccgggaggggagggggaaagaatccccacggct
gccacccgggtggttcaggatgcccgcaccttgatttttaccgcccaggtctggcacccg
gaaacccactatcaatggaaaatcaaccggtttctaccgcctgatgaacctttgctgatc
tatgaaactcatgtggggatggcattggaagacggcaggatcggcacatatgccgagttt
gaacatcatattttgcctaaaatcattgatgccgggtataatgcgattcaagtaatggct
atccaggagcatccttattatgcctcgttcggatatcatgtttccagcttttttgcggcc
tcatcccgattcggcactcctgaagaactcaagagcctgattgatgccgcccacaaaagc
ggcgtaagggtattgatggacatcattcattcccatgccgttaataatgaagtggaaggt
attgcaaaatttgacgggacctgttaccagttttttcacaatggcccaaaagggtatcac
cggcaatgggattccatgtgttttgattatggtaagcctgaggtgttaaagtttctttta
tccaacttaaaattatggatcgaagaatataaaattgacgggttccgttttgacgggatt
accagcatgatttttgaagatcatggcttgggacgggcatttacaagttatgcggattac
tatggggatgatgtggatgtggatgccctttcttatttgacgcttgccaacagtcttgtt
catgatatccaaccggagtttattaccattgccgaagatgtcagcgggtatccagggctt
gccgcgcccctgtcaaaaggtggaacagggtttgattaccgttatgccatgggtattgcg
gatttctggattaaattgttaaaagaggtcaaagatgaacactggcatcttgctactctc
tggcatgagttgacaaccaagagaaaagaagaaaagacaatcagttatgccgaatctcat
gaccaggcactggttggggataaaacccttatgatgcgcctgatgggcggccatatctat
acgtccatgcaaaagaataatgacagtattgaaaccttcaggggagtggccttgcacaag
atgatccgtctgattaccattgccactgcaggttcaggctacctgaatttcatgggcaat
gaattcggacatcctgagtgggtggattttccgtgtgagagaaataatttttcccatcat
tatgcccggcggcaatggtctttgaaatatgatcctgatctgtatttttactcattgtct
gaatttgaccagcagatgattaaacttgtgaaaacaaatgatctgttttcttgttcagac
gttaggcttttatgcgttcatgaggatgacaaggtgattgcctttgaaagaaataatatg
gtctttgtgtttaattttcatccgtccctctctttttcagattatatgtttgatgcgcca
ccgggcgagtataaactggttttcaattcagatgatatacggttcggtggaaaaggcagg
ttgaaaaaagaccagcatcattttacactttttgattccgacagatttggcaaaagaaat
ctgttgagcctgtatcttcccacaagaacagccattgtactgaaattgaaaaaaagacaa
taa

DBGET integrated database retrieval system