KEGG   Desulfobacula toluolica: TOL2_C25050Help
Entry
TOL2_C25050       CDS       T02268                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase NagZ (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dto  Desulfobacula toluolica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TOL2_C25050 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TOL2_C25050 (nagZ)
Enzymes [BR:dto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TOL2_C25050 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2939131..2940105)
Genome map
AA seq 324 aa AA seqDB search
MAGQRLMLGFDGIEFNEDLKCIIRDIKAGGIILFKRNIESPDQVAALCGECREYAKACGV
PPLFMAVDQEGGVVARLKAPFTEFKGNPFIESIRDAEDFAAVTADELKHAGINMNFAPVL
DIAPEGIDSIMKNRVFKGDAKNVSQLGMAVIHILQENGIMAVAKHFPGIGRTVKDSHFHL
PVLDIDLETLKQSDLVPFADATNEGVCGIMLSHIQYPQLDPRWQASLSPWIVHDLLRGQM
GYEGLVMTDDLDMKAIAYDMKTCVRQILKAGIDMALICHKGPDIDVAYHEIVRLLNENEK
LCLMGKISIERILRTKKKYLSERE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccggacagcgcttgatgctggggtttgacggtattgaattcaacgaggatttaaag
tgtattatccgggatatcaaagccggtggtatcatcttgtttaaaagaaatatagagtcc
cctgatcaggtcgcagctctttgcggtgaatgccgggaatatgcaaaagcctgcggggtt
ccgccgctgtttatggcggttgaccaggaaggcggggtggttgcaaggctgaaagcgcct
ttcacggaatttaaagggaatccctttattgaatccatccgtgatgccgaggactttgcc
gctgtcacagccgatgagttaaagcatgccgggatcaacatgaattttgctccggttctg
gatattgcacccgaaggcattgacagtatcatgaaaaaccgggtgtttaaaggggatgca
aaaaacgtatcacaacttggcatggccgtgatccatattcttcaggaaaatggcatcatg
gctgtggccaagcattttcctggtattggcagaacggttaaggattcccattttcatctt
cctgtattggatattgatcttgaaacccttaaacaatccgacctggttccgtttgcagat
gcaacgaatgaaggcgtctgcgggatcatgctgtcccatattcaatacccgcagcttgat
ccaaggtggcaggcaagcctgtccccttggattgtccatgaccttttacgcggtcaaatg
ggatatgaggggctggtgatgaccgatgatctggacatgaaagcgattgcctatgatatg
aaaacctgtgtccggcaaattttgaaagcaggaattgatatggccctgatctgtcataaa
ggccctgatattgatgttgcttatcatgaaatagtaaggcttctcaatgaaaatgagaag
ctttgtttgatgggtaaaatatcaatagaaagaatattaaggacaaagaaaaaatatttg
tccgaaagggaataa

DBGET integrated database retrieval system