KEGG   Desulfobacula toluolica: TOL2_C28110Help
Entry
TOL2_C28110       CDS       T02268                                 

Gene name
aor6
Definition
tungsten-containing aldehyde:ferredoxin oxidoreductase Aor6 (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dto  Desulfobacula toluolica
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dto01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dto00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3298775..3300511)
Genome map
AA seq 578 aa AA seqDB search
MGKILRINTKDKTTVFQDIPDFFAGLGGRALTSKMVLDEVPANCHPLGRSNKLVFAPGLL
TGTPAANSGRLSVGSKSPLTNGIKESNSGGLVSQKLARLGISALVLEDKPDDDTFSMIVI
KKDCVEILAADEYAGMGNYEVMEKLWDRYGKKTGLMTIGQAGEQRLKAASIQQADPKGRP
GRAMGRGGLGAVMGSKKIKAIIVDDKGCDRIVQADPEAFKAANKKWVELLKNHPVTGQGL
PGLGTAVLVNLINEAGALPTKNFRTGRFEHAADISGEKMVENIEARQGVVAEGCHPGCVI
KCSQAYHDKDGKYLTSGFEYETLWAFGAHTMVREIDDIAMMDRLCDDYGLDTIDTGVALG
VAMEGGLLEWGDGKACIELIKEIALGTGNGKILGNGAAFTGDALGVDRVPVVKRQALPAY
DPRSVKGVGVTYATSPMGADHTAGYGVTANILGVGGSIDPLKNDDQVELSKNLQIATAAI
DAAGLCLFVAFAVLDSEDGVQLIVDMLNAQYDIDLTPDDVVKLGISILENENEFNLMAGF
TKKDDQLPEMFNQTFPPHNTKWTFTEDELQDAKTFTVG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaatacttagaataaataccaaagacaaaacaacagtttttcaggacattcct
gatttttttgccggtctggggggaagagctttgacctctaagatggttctggatgaagtg
cctgcaaactgtcaccccttgggccgttcaaataaacttgtttttgcacccggactttta
accggaacaccggccgccaattcaggacgtctttccgtggggtcaaaatcacccctgacc
aatggcatcaaagagagtaattcaggcggacttgtttcacaaaaactcgcaaggcttggt
atttcagctcttgttctggaagacaagcctgatgatgacactttttcaatgatcgtgata
aaaaaagattgtgttgaaatccttgctgctgatgagtatgcgggcatgggaaactatgaa
gtaatggagaaactctgggatcggtacgggaaaaaaaccgggcttatgactattggccag
gcaggcgagcagcgtttaaaggccgccagcattcagcaggccgatcccaagggaagacct
ggtcgagccatgggaaggggagggcttggtgcggtaatggggtctaaaaaaatcaaggcc
attattgttgatgacaagggatgcgacagaattgtccaggcagatcctgaagcgtttaag
gcagccaacaaaaaatgggttgaactgctaaaaaatcatccggtaaccggccagggcctg
ccgggtcttggaaccgccgtgctggttaatcttatcaacgaggcaggtgctttgcccaca
aagaacttcaggacaggccggtttgaacatgcagcagatatcagtggcgaaaaaatggtt
gaaaacattgaagcacggcagggtgttgttgcagaaggatgccatccgggctgtgttatc
aaatgttcccaggcttaccatgataaagacggcaagtatctgacctcgggctttgagtat
gagaccctttgggcctttggagcccataccatggtcagggaaattgatgatattgccatg
atggacagattgtgtgatgattacgggctggacaccattgatacgggtgtggccctggga
gtggcaatggaaggcgggttgcttgagtggggtgacggcaaggcctgtattgaactgatc
aaagaaattgcccttggcacaggcaacggcaaaatacttggaaatggtgcggcttttaca
ggtgatgccctgggtgtggacagagttcccgtggtcaagcgccaggcattgccggcttat
gatccaagatctgtaaaaggggttggcgtaacctatgccacatcgcccatgggggcggac
catacagccggttatggcgtcacagcaaatattctgggggttggcggttccattgatcct
ttgaaaaatgatgatcaggtggaattgtctaaaaacctccagattgcgactgcagcaatt
gatgccgcaggcctttgcctgtttgttgcatttgctgtcctggacagcgaagacggcgtt
caattgattgttgacatgctcaatgctcaatatgacatcgacctgacaccggatgatgtt
gttaaactgggaatttccatcctggagaatgaaaatgagttcaatctcatggcgggattc
accaaaaaggatgatcagcttcctgaaatgttcaatcaaacttttccaccccataacaca
aaatggacctttaccgaagacgagcttcaggatgcaaaaacatttaccgtaggttaa

DBGET integrated database retrieval system