KEGG   Desulfobacula toluolica: TOL2_C28470Help
Entry
TOL2_C28470       CDS       T02268                                 

Gene name
sucC2
Definition
succinyl-CoA ligase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dto  Desulfobacula toluolica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOL2_C28470 (sucC2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TOL2_C28470 (sucC2)
   00640 Propanoate metabolism
    TOL2_C28470 (sucC2)
   00660 C5-Branched dibasic acid metabolism
    TOL2_C28470 (sucC2)
Enzymes [BR:dto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TOL2_C28470 (sucC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3345155..3346288
Genome map
AA seq 377 aa AA seqDB search
MRLHEYEGAEIFEKFGIPVPRRGVVRTVEGALNMADEIGYPVVLKSQVLVGGRGLAGGIK
IADSSDELEIMTDELLNMEIKGCRVKEIMISEKANIAKELYMAITIDGYSGKPIVVVSTE
GGVHIEKTAKESSDKIASAIIDPKFGFYPYQAQKLLRQLNLSPKPLTACSDILVRLYKVF
EKYEAIIAEINPLVILKNGGIVAVDAVLEIDDSAMFRLKKSLSLPSENRAGNSLENKGKE
IGVTYVDLEGDIGLISSGAGLGMASMDIIGNKLKPSNFLETGGGITADLLYKCMELIMMK
DLKAIFINIYGGINPIHEGAKGIVKYIKEHNLTIPIVAKALGNHQEETWEILKSGGVHVV
TEAATETAVDKLIALLK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagattacacgagtatgaaggcgcggaaatttttgaaaaatttggcataccggttcca
agaagaggagtcgtaagaactgttgaaggcgccttaaacatggcggatgagattgggtat
ccggttgttcttaaatcacaggtacttgttggcggacgcgggcttgccgggggaatcaag
attgccgactcatcggatgaacttgaaataatgacggacgagcttttgaatatggaaata
aaaggctgtcgtgtcaaagagataatgatcagtgaaaaagcaaatattgcaaaagaactc
tacatggccatcacgattgacgggtattcaggaaaacccattgttgttgtcagcactgaa
ggcggtgtccatattgaaaaaaccgcaaaagaatcatccgacaagatcgcctcggcaata
atagatccaaaatttggattttacccttaccaggcacaaaaacttttaaggcagcttaat
ctgtccccaaaacctttaacagcctgttccgacatcctggtgcgtctttacaaggtgttt
gaaaaatacgaggccataatagctgaaatcaatccccttgtcattttaaaaaacggtgga
attgtggcggttgacgcggttcttgaaattgatgactctgccatgttcagactcaaaaaa
tccctttcattgcccagtgaaaaccgagcgggaaattcccttgaaaacaagggaaaagaa
attggggttacctatgttgatcttgaaggagatattggattgatttcgtccggtgcaggt
ctgggcatggcatcaatggatattatcggcaacaaattaaaaccttcaaacttccttgaa
acaggcggcggtataacagcagatcttctctataaatgcatggagttgatcatgatgaaa
gatttgaaagccatcttcataaacatatatggcggcatcaatcccattcatgaaggggct
aaagggattgtaaaatacatcaaagaacataatctgaccattcctattgttgcaaaggct
cttggaaatcaccaggaggaaacatgggaaattttaaaatccggtggtgtccatgttgta
accgaagcagcgactgaaactgcagttgacaagctgattgcccttctaaagtaa

DBGET integrated database retrieval system