KEGG   Desulfobacula toluolica: TOL2_C36000Help
Entry
TOL2_C36000       CDS       T02268                                 

Gene name
acsA5
Definition
acetyl-coenzyme A synthetase AcsA5 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dto  Desulfobacula toluolica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOL2_C36000 (acsA5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOL2_C36000 (acsA5)
   00620 Pyruvate metabolism
    TOL2_C36000 (acsA5)
   00640 Propanoate metabolism
    TOL2_C36000 (acsA5)
  Energy metabolism
   00680 Methane metabolism
    TOL2_C36000 (acsA5)
Enzymes [BR:dto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TOL2_C36000 (acsA5)
Lipid biosynthesis proteins [BR:dto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TOL2_C36000 (acsA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4201779..4203539)
Genome map
AA seq 586 aa AA seqDB search
MKELFKEVIRINMMEDALATQECAKKLFIQLNAMEIPEYFNWASDIFEDLHVKENPDKKA
LIWTDLDTRETKTYSYGTLFQKANQLINFFHKSGVEKGDSLYMMTPNLPENWFACLGCIK
AGIVSVPTATTMTQRELEFRFEIYPPNVVVADQASADLIDKALEEIKFQPKLKLVLGQKA
GWTCFDVIENESFDAKAAKTKSDDILFCFFTSGTTGLPKRVGHTAVSYPVGHLSTAVMIG
VRPDDIHHNLSAPGWAKWCWSSFFAPFNVGATTIGFKYSFLDGEQYLDAVSRHKVTTFCA
PPTVWRTFVNMNLDSFDLSCLRNSVSAGEPLNSDVIEKWKKYTKTQIRDIYGQTESTAMI
GTPPWKKENIRPGSFGNPFFMYDMALADDEGNEITQADQVGHIVVKLNNWRPIGLFSEYI
GNPEKMSSVFVDNYYYTGDRASFDEDGYWWFVGRADDVIKSSDYRIGPFEVESALVEHPA
VSEAAVVGSPDPNRYQLVKAYVILNPNYQASRELALELFKHTVTILPKFKIPRMIEFVPE
VPKTISGKIRRIELRQIEITKHGNSVDEGIKEYFYWDFPELSSKKK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagctttttaaagaggttatcaggataaatatgatggaagacgccttggccact
caagagtgtgccaaaaaattatttatccaattaaatgcaatggagatccctgaatatttt
aattgggcctcagacatatttgaagatcttcatgtcaaagaaaatccagataaaaaagct
ttgatctggacggatcttgataccagagagaccaaaacatattcttatggaactctattt
caaaaggcgaatcagctgatcaactttttccataaatcaggcgttgaaaaaggggatagc
ctctatatgatgacgccgaacttgcctgagaactggtttgcctgtctggggtgtatcaag
gccggaatagtgagcgttccaacggcaacgacaatgactcaaagagagttggaatttcgg
tttgaaatttatcctcccaatgtggttgtggctgatcaagcatcggcagatcttattgat
aaagctctcgaagaaataaaatttcaacccaaacttaaattggttttaggacaaaaggca
ggatggacatgctttgatgtgattgaaaatgaatcttttgatgccaaagcagcaaagaca
aaatctgacgatatccttttttgcttttttacctcgggaacaaccggacttcccaagcgt
gtcgggcacacagcagtatcatatcctgtgggacatttgtcaactgctgtaatgattggt
gtcaggccggatgatattcatcacaacctgagcgcccctggatgggcaaagtggtgctgg
tcaagtttttttgccccttttaatgtcggtgccacaacaatcgggtttaaatattcattt
ctggatggcgaacaatatcttgatgcagtctcaaggcataaagtgacaactttttgcgcc
cctccgactgtatggagaacttttgtgaatatgaatcttgactcttttgacctgtcttgc
ctgcgaaactcggtcagtgcaggtgagcctttgaattccgatgtgattgaaaaatggaaa
aaatatacaaaaacacaaatcagagatatttatggtcagacagaatcaacagccatgatt
ggaactcctccatggaagaaagaaaatataaggccaggatcttttggaaatccgtttttt
atgtatgatatggcattggctgatgatgaaggcaatgagatcactcaggcggaccaagtg
gggcatattgtggtcaaactgaacaactggagaccaatcggacttttttcagaatatatc
ggtaatcctgaaaaaatgagttctgtatttgttgataattattattataccggggaccgt
gcatcctttgatgaggacgggtattggtggtttgtgggaagagccgatgatgtgattaaa
tcttcagattacaggattggtccatttgaagttgaaagtgcccttgtagaacatcctgcc
gtgtcggaagccgcagttgtaggttcgcctgatccaaaccggtatcagcttgtaaaagcc
tatgtgattttaaatccaaattatcaggcatccagggaactggcgctggaactttttaaa
catactgttaccattttgccaaaatttaagattcccaggatgatagaatttgttcctgag
gttccaaaaaccataagtggtaaaatcaggagaattgaattacggcagattgaaattacc
aaacacggcaattcggttgatgaaggcattaaagaatatttttattgggattttccggaa
ctgagttctaaaaaaaaataa

DBGET integrated database retrieval system