KEGG   Desulfobacula toluolica: TOL2_C38060Help
Entry
TOL2_C38060       CDS       T02268                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
dto  Desulfobacula toluolica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4465776..4466813
Genome map
AA seq 345 aa AA seqDB search
MNYMEEKTKAGEYLRLALNYITKHNLPATPVNYAVWYEYVSGKNIKLKKAIDHSLKNAGP
INNVKVEGLYQKYVVDGDRIVISNLLTKISLMLKDISNHVSETKEDLAENGKSLNELAVK
INDAKNFNEIRCIVDQMLAETKGLLQSGKRLQTRMRISSEDLKQLQQELEKSQQEAQTDA
LTGLINRRGLEKKLEIERIRAKQNDLPFSIIMVDIDYFKRVNDTFGHLVGDSLLRGIAQI
LKTHLRQNDIAARYGGEEFLIILPETGIKGATTVAKKIQKTLATKEWKLRKSGETMGKIT
VSMGISLYRMNEPEASLIKRADDALFIAKNKGRDQIVIQKEQEEF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatggaagaaaaaaccaaggcaggggaatacctgagactggcattaaattat
attacaaaacacaatctgcctgccaccccggtaaactatgcggtctggtacgagtatgta
tccggtaaaaatataaaactcaaaaaagccattgatcactcacttaaaaatgccggcccg
attaataacgtcaaagtagaaggcctttatcaaaaatatgtggtagatggagataggatt
gtcatcagcaatctgttaaccaagatttctctgatgctcaaagatatttccaaccatgtc
tccgaaaccaaggaggatcttgccgaaaacggcaagagcctgaacgagttagcggttaag
ataaatgatgccaaaaattttaatgaaataagatgtattgttgaccagatgctggctgaa
accaaaggactcctccaatcaggcaaaagacttcaaaccaggatgagaatatcttctgaa
gatttaaagcaattgcaacaggaattggaaaaatcccagcaggaagcacagacagacgct
ttaaccggattgattaacaggagagggcttgaaaaaaagcttgagatagaaagaatcagg
gccaaacaaaatgatttgcctttttccattattatggtggatattgattatttcaaacgg
gtgaatgacacctttgggcatcttgtaggagacagtcttttgagaggtattgcccagatt
ctgaaaactcatttgagacaaaacgacattgctgccagatacgggggagaggagttttta
ataattttacctgaaacaggaatcaaaggtgcaacaaccgtggctaaaaaaattcaaaaa
actctggccacaaaggagtggaagctcagaaaatccggtgaaaccatgggaaaaattacg
gtttccatgggaatttccctgtaccggatgaatgaaccggaagcaagtcttataaaacgg
gcggatgatgcacttttcatagctaaaaacaaaggtcgagatcagattgttatccagaaa
gaacaggaagagttttaa

DBGET integrated database retrieval system