KEGG   Desulfobacula toluolica: TOL2_C38060Help
Entry
TOL2_C38060       CDS       T02268                                 

Definition
(GenBank) predicted diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
dto  Desulfobacula toluolica
Brite
Enzymes [BR:dto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     TOL2_C38060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4465776..4466813
Genome map
AA seq 345 aa AA seqDB search
MNYMEEKTKAGEYLRLALNYITKHNLPATPVNYAVWYEYVSGKNIKLKKAIDHSLKNAGP
INNVKVEGLYQKYVVDGDRIVISNLLTKISLMLKDISNHVSETKEDLAENGKSLNELAVK
INDAKNFNEIRCIVDQMLAETKGLLQSGKRLQTRMRISSEDLKQLQQELEKSQQEAQTDA
LTGLINRRGLEKKLEIERIRAKQNDLPFSIIMVDIDYFKRVNDTFGHLVGDSLLRGIAQI
LKTHLRQNDIAARYGGEEFLIILPETGIKGATTVAKKIQKTLATKEWKLRKSGETMGKIT
VSMGISLYRMNEPEASLIKRADDALFIAKNKGRDQIVIQKEQEEF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatggaagaaaaaaccaaggcaggggaatacctgagactggcattaaattat
attacaaaacacaatctgcctgccaccccggtaaactatgcggtctggtacgagtatgta
tccggtaaaaatataaaactcaaaaaagccattgatcactcacttaaaaatgccggcccg
attaataacgtcaaagtagaaggcctttatcaaaaatatgtggtagatggagataggatt
gtcatcagcaatctgttaaccaagatttctctgatgctcaaagatatttccaaccatgtc
tccgaaaccaaggaggatcttgccgaaaacggcaagagcctgaacgagttagcggttaag
ataaatgatgccaaaaattttaatgaaataagatgtattgttgaccagatgctggctgaa
accaaaggactcctccaatcaggcaaaagacttcaaaccaggatgagaatatcttctgaa
gatttaaagcaattgcaacaggaattggaaaaatcccagcaggaagcacagacagacgct
ttaaccggattgattaacaggagagggcttgaaaaaaagcttgagatagaaagaatcagg
gccaaacaaaatgatttgcctttttccattattatggtggatattgattatttcaaacgg
gtgaatgacacctttgggcatcttgtaggagacagtcttttgagaggtattgcccagatt
ctgaaaactcatttgagacaaaacgacattgctgccagatacgggggagaggagttttta
ataattttacctgaaacaggaatcaaaggtgcaacaaccgtggctaaaaaaattcaaaaa
actctggccacaaaggagtggaagctcagaaaatccggtgaaaccatgggaaaaattacg
gtttccatgggaatttccctgtaccggatgaatgaaccggaagcaagtcttataaaacgg
gcggatgatgcacttttcatagctaaaaacaaaggtcgagatcagattgttatccagaaa
gaacaggaagagttttaa

DBGET integrated database retrieval system