KEGG   Desulfobacula toluolica: TOL2_C39760Help
Entry
TOL2_C39760       CDS       T02268                                 

Gene name
aor7
Definition
tungsten-containing aldehyde:ferredoxin oxidoreductase Aor7 (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dto  Desulfobacula toluolica
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOL2_C39760 (aor7)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TOL2_C39760 (aor7)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TOL2_C39760 (aor7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4650672..4652399
Genome map
AA seq 575 aa AA seqDB search
MGKLLRVNTQNKTFGFEQVPKAYAGLGGRALTSKMILDEVPATCHPLGKANKLIFAPGIM
SGSPAADSGRLSAGAKSPLTGGIKESNAGGLVSQKLAKLGITALVLEGKPQTEGYSIIVI
NKDEVEILDAGHLAGKGNYEVMENLWQKYGKSVGVLSIGQAGEQCLKGASIQQADMNGRP
GRAHGRGGLGAVMGAKRIKAIVVDDKGAGRLEIKDPDAFKAANKKWVDMLRKHPVTGQGL
PALGTAVLVNVINEAGTLPTKNFRSGRFEHAQDISGEKMAQNIEQRGGITTEPCHPGCVI
RCSNVYHDKKGKYLTSGFEYETIWAFGAHTTIRELDDIAMLDRMCDDFGLDTIETGVAIG
IAMEGGMIPWGDGKAAIDLLSKVGTAAPEGKIIGNGALFTGDALGVDRVPVVKKQAFPAY
DPRACKGVGVTYATTPMGADHTAGYGVTANILGVGGTIDPLKKEGNVELSQGLQIATAAI
DAAGLCLFVAFAVLDNEDGLPTIVEMINAQHGLSLTPDDVLELGKSILNNEKEFNKKAGF
TQVDDQLPEMFNETFPPHNTKWDFSSEELSKTLSF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggggaaattattaagggttaacacccaaaacaaaacctttgggtttgaacaagttccc
aaagcttatgcaggtcttgggggccgggcgctcacatccaaaatgattctggatgaagtg
cctgcaacctgtcacccgcttggaaaagcaaacaaattaatctttgcacccggcattatg
tccggatctcctgccgcagattcaggacggctttcagcaggagccaaatcgcctcttaca
ggcggcatcaaagagagcaacgcaggcggacttgtttcacagaaactggccaaactgggg
atcaccgcccttgttctggaaggcaaaccccaaacagagggttacagcatcattgtcatc
aataaggatgaagttgaaatccttgatgcaggccatcttgcgggcaagggcaattatgag
gtcatggaaaatctatggcaaaaatatggcaaatcagttggagtcttaagcattggccag
gcaggcgaacaatgtttgaagggcgcaagcatccagcaggccgacatgaacgggagaccg
ggacgtgcccacggcagaggcggtttgggagcggttatgggggcaaaaagaatcaaagcc
attgtcgtggatgataagggtgcaggacgtcttgaaataaaagatccggatgcctttaaa
gcagccaataaaaaatgggtggacatgctcagaaaacatccggttacaggacaaggcctt
cccgcacttggtacggcagtattggtaaatgtcatcaatgaagcaggcaccctgccaaca
aaaaatttcaggtcaggccggtttgagcatgcccaggacatcagtggggaaaaaatggca
caaaacattgagcaaagagggggtattacaacagagccctgccatccgggttgtgtgatc
agatgctccaatgtttaccatgacaagaaaggcaaatatctcacctccgggtttgaatat
gaaaccatctgggcatttggtgcccacaccaccatcagggagctggatgatattgccatg
ctggacaggatgtgtgatgacttcggtcttgataccattgaaacgggagttgccatcggc
attgccatggaaggcggcatgattccatggggagacggcaaggctgccatagatcttctg
tccaaagtcggaacggctgcaccagagggtaaaatcattggaaacggcgctttgttcaca
ggagacgccctgggcgtggacagagttcccgtggtaaaaaaacaggcattcccggcctat
gacccgagagcatgcaaaggggttggggtcacctatgccacaacgccaatgggtgcggat
catacggcaggctatggggttacagccaatatcctgggcgtgggaggcactattgatcct
cttaaaaaagagggtaatgttgaattgtcacaggggcttcaaatcgcaacagctgccatt
gatgcagccgggctttgcctatttgttgcttttgccgttcttgacaacgaagacgggctt
ccaaccatcgtggagatgatcaatgcacagcatggcctttctctaacaccggatgatgtt
ctggaacttggaaaatcaatattaaacaatgaaaaggaattcaacaaaaaagcagggttc
acacaagttgatgatcagcttcctgaaatgtttaacgaaacatttccccctcataacacc
aaatgggatttttcttccgaagaattatcaaaaacactcagcttttaa

DBGET integrated database retrieval system