KEGG   Desulfobacula toluolica: TOL2_C40000Help
Entry
TOL2_C40000       CDS       T02268                                 

Definition
(GenBank) diguanylate cyclase (GGDEF) domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
dto  Desulfobacula toluolica
Brite
Enzymes [BR:dto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     TOL2_C40000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4686154..4687197
Genome map
AA seq 347 aa AA seqDB search
MISKTYTESVKESGNYLRSALKNIAKYKLPYNPVSYLLWYEYALGQNKDLIDDIELIFKT
NQLLTNDTISKLFKKHITDNQILISGKKIREFQKILAQMTKHLSQSGDEIGLQGNMLNTY
AIELGQASSLDAIIEISKHIVLETKSIVESSKNLKSRLDSTVSEINMLSKELDGIRQAAK
TDMLTGLLNRRGFYGAMVQAIANIENANDMLSVIMLDIDHFKRVNDQYGHLIGDNVLKIL
SKLLKDHIKGKDIAARFGGEEFILVLPQTSLEGAYALAEQIRLSLLKMNWKIKDTGKSIG
QITISLGISLYQEGESIEAVIKRADDALYHAKNTGRNKSVTEVEIAN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgataagcaaaacctatacggaatctgttaaagaatcagggaattatttgagaagtgcc
ttgaaaaatattgccaaatataaacttccgtataatcctgtttcatatttattatggtat
gaatatgctcttgggcaaaataaggatttgattgatgatattgaattgatttttaaaaca
aatcaattacttacaaacgataccatttctaagctattcaaaaaacacatcacagataat
caaatactgatttcgggaaaaaaaatcagggaatttcaaaagatattagcgcaaatgacc
aaacacctgagtcaatcaggcgacgaaatcggccttcaaggcaatatgctgaatacatat
gccatagagctgggccaggcaagctctttagatgcaataattgaaatctctaaacatatt
gttttggaaacaaaatcaatagttgaatccagcaaaaaccttaagagcaggcttgattca
acggtttctgaaattaacatgctgagtaaggaattggacggaatacggcaggctgccaaa
accgatatgctgaccggtcttttaaaccggagggggttttatggtgccatggttcaagcc
atagcaaacatagaaaacgccaatgacatgttatccgtcattatgcttgatattgatcat
tttaaacgagtgaatgatcaatacggacatcttattggtgacaatgttttgaagatactc
agtaaattactaaaagaccatataaagggcaaggatattgctgcccggtttggaggcgaa
gagtttattctggttcttccccagacatcccttgagggtgcttatgcactggctgaacaa
atcaggttgagtctgctaaaaatgaattggaaaattaaagatacgggtaaatcaataggg
cagataaccatatctttaggtatttccttgtatcaggagggtgaatccattgaggctgtt
attaaaagagcggatgatgccctttaccatgcaaaaaatacaggcagaaataaatctgtt
actgaagttgagatagcaaattaa

DBGET integrated database retrieval system