KEGG   Desulfobacula toluolica: TOL2_C40110Help
Entry
TOL2_C40110       CDS       T02268                                 

Gene name
recD2
Definition
helicase, RecD/TraA family RecD2 (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dto  Desulfobacula toluolica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dto03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4697998..4700160
Genome map
AA seq 720 aa AA seqDB search
MITIKGILDKVTYQNRENHYTVAKLRIPKISDPVTIVGYLAGVVEGEGLEISGKWVSHPR
YGDQFKAQSYKVVLPATVSGIRKYLGSGMIKGIGKSLAEKIVDYFAENTLDIIENEPEKL
KRIHGIGEVKKNRIEKAWNKHHSVRRVMQFLQENDVGVYHAATILQTYGSEALNILQHDP
YVIARDIPQIGFPIADMIAMKAGVQKDDENRLQACLIHILLSFEQEGHVYGLKQEVFLSG
SRTSGVEPDKFEQALKALTDSDDIKIQIDDDETKLYLKRLYHAESGIASRMKAILSCVKN
VASLPQQVGKDKILEEVLTKIAVKLSKEQLNVVTKVLHEKIVVITGGPGTGKTTLIRALC
EIFKLQNQKVVLSAPTGRAARRLSEVTGKQAFTLHKLLGFDHESQTFEKNFANPLELDIF
IVDEASMVDTQLMYCLIEALPVFASLIIVGDTFQLPSVGPGNVLSDIIDSNRVKVFFLTK
IFRQAKQSPIIMHAHSIRNGEMPDLQKPGEGQLSEFYFIENQRPEKVVETILELCSKRIP
QAFPHIDEIQVLTPMHRGEAGTINLNQQLQKVLNDSKGGIAAGGITFKANDKVMHLKNNY
DKEVFNGDIGIIHEIIKSENKVMVDYDGRIVEYDILELDELALAYAISVHKSQGSEYAAV
IIALTTAHFPLLQRNLLYTAMTRGKKLVVIVGSSKAMELALNNNKTALRLTGLKQKLMSV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgataaccatcaaaggcattttagacaaagtcacctatcagaatcgggaaaatcattat
acggttgcaaaacttcgaattcctaaaatcagtgatcctgttaccattgttggatatctt
gccggagtggttgaaggtgaaggccttgaaatatcaggaaaatgggtttcacatcccagg
tatggggaccagtttaaagcacagtcgtacaaggttgttttgcctgccactgtttcaggc
attcgcaaatatctgggctcgggtatgattaaaggcattggcaaatccctggccgaaaaa
atagtggactattttgcagaaaacacccttgatattattgaaaacgaaccggaaaaatta
aaacgtattcacggcataggagaggtcaagaaaaaccgcattgaaaaggcatggaacaag
catcattccgtcagaagggtcatgcagttcctccaggaaaatgatgtgggcgtgtaccat
gccgccaccattcttcaaacttatggctccgaggctttgaatattttgcagcatgatcca
tatgtcattgcaagggatatccctcaaatagggtttcccatcgccgatatgattgccatg
aaagccggggtgcaaaaagatgatgaaaaccgccttcaggcatgcctgatacatatcctg
ttgtcttttgaacaagaggggcatgtgtatggattaaaacaagaagtgttcctgtcgggt
tcaagaacatcgggtgtggaaccggataagtttgagcaggccctgaaagctttgactgac
tctgatgacataaagatccaaattgatgacgatgaaacaaaactctatcttaaacgcctt
tatcatgctgagtcaggtattgcatcacggatgaaagccattttatcctgtgtgaaaaat
gtggcttctttaccccaacaagtgggaaaagacaagattcttgaagaagtgctgacaaaa
attgccgtaaaattatccaaagaacaattgaatgttgtgaccaaagtgctgcatgaaaaa
attgtggtcatcacaggagggcctggaaccggtaaaacaaccctgataagggcattgtgt
gaaatttttaaattgcagaatcaaaaggtcgtattaagtgcgcccactggcagagctgcc
aggcgcctttcagaggtcacgggaaaacaggcctttaccctgcacaaacttttgggcttt
gatcatgaaagccaaacgtttgaaaaaaattttgccaatccccttgagctggatattttt
attgtggatgaagcctccatggtggatacacagctcatgtattgtcttattgaagccctg
ccggtatttgcaagcctgatcattgtcggagatacctttcagctgccttccgtgggaccg
ggcaatgtgttgtccgatatcattgattccaaccgtgtaaaagtcttttttttgacaaaa
atattcagacaggccaaacaaagccctattatcatgcatgcccacagcatcaggaacgga
gaaatgcctgacttgcaaaagcccggggaagggcaattatcggaattttattttattgag
aaccagagacctgaaaaagtggttgaaaccattcttgaactttgttcaaaaagaattccc
caggcatttccccatattgatgagatacaggtattaacgcccatgcaccggggggaggcc
ggaaccattaacctgaaccaacagcttcaaaaagtgttaaatgattctaaaggcggtata
gctgccggagggataacgtttaaagccaatgacaaggttatgcatttaaaaaacaattat
gacaaagaggtttttaacggtgatataggtattattcatgaaatcattaaatctgaaaac
aaagtcatggtggattatgacggtcgaattgttgaatatgacatcctggaactggatgaa
ctagcactggcctatgccatatccgtccacaaatcccagggaagtgagtatgcagctgtt
attattgctctgacaacggcccattttcctcttttgcagagaaatcttttgtatactgcc
atgacccggggcaaaaagttggtggtcattgtgggatcatcaaaagccatggaattggca
ttgaacaataataaaaccgcattgcgccttaccgggcttaaacaaaaactgatgagtgtg
tga

DBGET integrated database retrieval system