KEGG   Desulfobacula toluolica: TOL2_C41270Help
Entry
TOL2_C41270       CDS       T02268                                 

Gene name
trpB2
Definition
(GenBank) TrpB2: tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dto  Desulfobacula toluolica
Pathway
dto00260  Glycine, serine and threonine metabolism
dto00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01130  Biosynthesis of antibiotics
dto01230  Biosynthesis of amino acids
Module
dto_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOL2_C41270 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TOL2_C41270 (trpB2)
Enzymes [BR:dto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TOL2_C41270 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCK82283
UniProt: K0NQ41
Position
4857852..4859078
Genome map
AA seq 408 aa AA seqDB search
MKNRGYYGNHGGAFLPEILVATFDELEIEFEKIKKDPSFWKEYETLMGSYSCRPTPLTFA
DNLTREFGGAKIYIKREDLNHTGAHKANNVMGQGLLVKRMGKKRVIAETGAGQHGVATAT
MAAKFGFDCTIYMGEVDVLRQRPNVFWMEQLGATVVPVKDGTRILKDAINEAFRDWVTNM
DTTHYVLGTACGPHPFPEMVSYFQSIIGKEARQQILDVEGKLPKRVYACVGGGSNAMGIF
SGFLNDPVELVGVEAGGKGLNSGMHASRLSSADGSHGIAQGYKTYFLQDDDGQMKETHSI
SAGLDYVGVSPILSHMHDQGTARFESATDTEVVAALKLTMQKEGIIPALESAHAFARAFK
EAPSLSKDDVIIINQSGRGDKDIFTVAEAVNDPKWKEFIIEKAKEYNA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaggggatattacggtaaccatggcggggcatttttgcctgagattctggtt
gccacgtttgatgaactggaaattgagtttgaaaaaataaaaaaagatccgtctttttgg
aaagagtatgaaaccttgatgggatcttactcctgccgtcccacccctttgacctttgct
gacaaccttacccgggaatttggcggtgcaaaaatatatatcaagcgagaagacctcaat
cacacaggcgcccacaaagccaacaatgtaatgggtcaggggctgctggtcaaacgcatg
ggaaaaaaacgggtgattgcggaaacaggggcaggacagcacggggtggcaactgccaca
atggcggcaaagttcggatttgactgcaccatctacatgggggaagtggatgtgttgcgc
cagcgtcccaatgtgttctggatggagcagttaggtgccaccgtggttccggtaaaagac
ggcacaagaattttaaaggatgccatcaacgaagcgttccgggactgggtaacaaacatg
gacaccacccattatgtcctgggaaccgcctgcgggccacaccctttcccggaaatggtc
tcttattttcaatccattattggcaaggaggcaagacagcagattctggatgtggaaggc
aaacttcccaaacgggtatatgcatgcgtgggcggcgggtccaatgccatggggattttt
tcaggatttttaaatgatcctgtggagcttgtgggggttgaggcaggaggcaagggttta
aattcaggcatgcacgcctcccggctgagttcggcagatggaagccatggtattgcccag
gggtataagacctattttcttcaggatgatgacggccagatgaaagagacccactctatt
tcagccgggctggattatgtgggggtgtctccgattttatcccacatgcatgaccaggga
acggcaaggtttgaaagcgcaacagatactgaggttgtggctgcgctgaaactgaccatg
caaaaagaaggaattatcccggccctggaatctgcccatgcttttgccagggcatttaag
gaagcgccttccctttcaaaagacgatgtgatcatcatcaatcagtccggcaggggtgac
aaggacatttttacagtggcagaggctgttaatgatcccaaatggaaagaatttattatt
gaaaaggccaaagaatacaatgcttga

DBGET integrated database retrieval system