KEGG   Desulfobacula toluolica: TOL2_C41280Help
Entry
TOL2_C41280       CDS       T02268                                 

Gene name
trpA
Definition
(GenBank) TrpA: tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dto  Desulfobacula toluolica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOL2_C41280 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOL2_C41280 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TOL2_C41280 (trpA)
Enzymes [BR:dto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TOL2_C41280 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4859071..4859832
Genome map
AA seq 253 aa AA seqDB search
MLESYIKDRLKNRDILLMTHIVMGYPSFEDCFEIVRQMVDAGVDLMELQLPFSEPMADGP
VILKANQAALEKGSTVQKCFEFARAVSKEFSIPFLFMSYANILFKYGMEKFSDKMVQINL
KGAIVPDLPPEEGKEYICAMQKNNLDPIYIFSPETSDERLAYLASHASGFVYCLARKGVT
GKDTAFSDDLAVYLSRCRKATDLPLAVGFGVKEKADVDYLKGKADIAVIGSQTIRIVEEK
GAAAAGEFIRSLL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatcctatataaaagaccgactcaaaaaccgtgatattttgttgatgacccat
attgtcatggggtatccctcctttgaagactgttttgaaatcgtaaggcagatggttgat
gccggagtggatttaatggaattgcaattgccgttttcagaacccatggcagacggtcct
gtgattttaaaagccaaccaggcagctctggaaaaagggtcaaccgttcaaaaatgcttt
gaatttgcccgggccgtatcaaaggaattttccatcccgtttttgttcatgagttatgcc
aacattctttttaaatacggaatggaaaaattttcagacaaaatggttcaaataaatcta
aaaggtgccattgtgccggatctgccgcctgaagagggcaaagagtatatctgtgccatg
caaaaaaataatctggaccccatttatattttttccccggaaacaagcgatgagagactg
gcatatttagcctcccatgcctcaggctttgtctattgccttgccaggaaaggggttacc
ggaaaagacactgctttttcagatgatcttgccgtttatctgtcaaggtgtcgaaaggcc
actgaccttcctttggccgtgggattcggcgtaaaagaaaaagctgatgtggactattta
aaaggcaaggcagatattgccgtgatcggctcccagactatcaggatcgtggaagaaaaa
ggtgctgctgcagccggggagtttatccgcagccttttgtaa

DBGET integrated database retrieval system