KEGG   Desulfobacula toluolica: TOL2_C41570Help
Entry
TOL2_C41570       CDS       T02268                                 

Gene name
padE2
Definition
phenylglyoxylate:acceptor oxidoreductase subunit E PadE2
Orthology
K18357  
phenylglyoxylate dehydrogenase gamma subunit [EC:1.2.1.58]
Organism
dto  Desulfobacula toluolica
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TOL2_C41570 (padE2)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     TOL2_C41570 (padE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4916076..4916648
Genome map
AA seq 190 aa AA seqDB search
MFEMRFHGRGGQGAVMASKILAKALVEEGHVVKAIPSFGFERRGAPVSAFLRFGDKEIRQ
VTNIYNPDCIVCLDPTLSKSVDIFEGINDNAIFIQATKKDISELSFPDTLSKVGTCDAFG
LAMEIIGRPITNTIMLGVFAKTTGLVSVGSINKAMESVAFRDAALNKNITAVKLGYERTT
VLELKGKEIS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaatgcgttttcatggacgagggggtcaaggagctgtgatggcatccaaaatt
ttggcaaaagccctcgtcgaagaaggtcatgttgttaaagcgattccctcattcgggttt
gaaaggcgcggtgcgccggtatccgcctttctgcgtttcggagacaaggaaatcagacag
gtgacaaatatttacaatccggattgcatagtgtgtcttgatccaaccctttccaaatcc
gtggatatttttgaaggcatcaatgataatgccatatttattcaggcaacaaagaaagat
atatctgaattatcatttccagataccctttcaaaagtcggcacatgtgatgccttcggt
cttgccatggagatcatcggaaggccaattacaaacacaataatgcttggcgtgtttgca
aaaaccaccgggcttgtgtctgtgggttcaattaataaagccatggaatccgttgctttc
agggatgccgccctgaataaaaatattaccgctgtaaaattagggtatgagagaaccact
gtgcttgaacttaaaggaaaggagatatcatga

DBGET integrated database retrieval system