KEGG   Desulfobacula toluolica: TOL2_C41580Help
Entry
TOL2_C41580       CDS       T02268                                 

Gene name
padF2
Definition
(GenBank) PadF2: phenylglyoxylate:acceptor oxidoreductase, subunit F
  KO
K18358  phenylglyoxylate dehydrogenase delta subunit [EC:1.2.1.58]
Organism
dto  Desulfobacula toluolica
Pathway
dto00360  Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TOL2_C41580 (padF2)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     TOL2_C41580 (padF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_16 Fer4_21 Fer4_2 Fer4_9 Fer4_6 Fer4_7 Fer4_10 Fer4_17 Fer4_15 Fer4_8 Fer4_13
Motif
Other DBs
NCBI-ProteinID: CCK82314
UniProt: K0NCP3
Position
4916645..4916938
Genome map
AA seq 97 aa AA seqDB search
MIKQSTPAFDSSTIPNDLCPIATHFVFLKTGDWRAMRPILLREKCVKCATCWLYCPTQCI
SEKATWFEANLDICKGCGICAEECPHNAIIMEEETEV
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaatccacccccgcctttgacagttcaacgattcccaatgatttgtgtccc
attgcaacacattttgtgtttcttaaaaccggtgactggagggccatgcgccccattctc
ctgcgggaaaaatgtgtgaagtgtgccacctgctggctttattgccctactcagtgcatt
tctgaaaaagcaacatggtttgaagcaaatcttgatatttgcaagggatgcggaatctgt
gcagaggaatgcccccataatgcaatcataatggaagaggaaactgaagtatga

DBGET integrated database retrieval system