KEGG   Desulfobacula toluolica: TOL2_C41590Help
Entry
TOL2_C41590       CDS       T02268                                 

Gene name
padG2
Definition
phenylglyoxylate:acceptor oxidoreductase subunit G PadG2
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
dto  Desulfobacula toluolica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:dto01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dto00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dto00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dto00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dto00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dto00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:dto00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dto00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4916935..4918131
Genome map
AA seq 398 aa AA seqDB search
MTEKIVCDGNEAAAWGVAKAKPDMVAVYPITPQSSLAEYIAQFVADGVIDADLMDVEGEH
SVLSVLQGACLAGARTYTATCGQGLAFMFEPYFRTPPLRLPIVMSIVTRDGITPQCVWGG
QQDAMTVKEVGWIQMYCETNQEILDTMILAYRIAENRDVMLPVNVCHDGNYQSYGVEQVL
LPDQDMVDGFLGEKNTNWHAALDPEKPMGIDPLTGGAGGEGPSRFVRYRKGSCKGMQNAL
DVITNVHEEWGELTGRHYAPLVEEYRLDDADYAIVTIGGMTGAGKDAVDEMRLEGENVGL
IKIKTFRPFPQEALLKAVSKVAAVGVVDRSVNFGWNSGPVYQEILGILYQMEKKIPAVSF
IGGLAGADITINDFKDTIMTTKRALNGDLPKSTIWINE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaaatagtttgtgacgggaatgaagcggctgcatggggtgttgccaaagcc
aaacctgatatggtcgcagtatatcctataactcctcaatcttcccttgccgagtatatt
gctcagtttgtggcggacggggtgattgatgctgatttgatggatgtagaaggagaacac
agtgttttgtcggttctccagggagcatgtcttgcaggggcaaggacctatacggctacc
tgtggccaggggcttgcttttatgtttgagccttattttcgaacaccgcctttaaggctt
cccattgttatgtccattgtgacacgggacggcattacccctcaatgtgtatggggaggg
caacaggatgccatgacggtaaaagaagtcggttggattcaaatgtattgcgaaacaaac
caggaaattcttgacaccatgatcctggcttacaggatcgcggaaaatcgagatgttatg
ttgccggtgaatgtatgtcatgatggaaattatcaatcttacggcgtagagcaggtttta
ctgccggatcaggatatggtggatgggtttcttggcgaaaaaaatacaaactggcatgct
gctcttgatcctgaaaaacccatgggaattgatcctttgacaggtggtgcaggcggtgag
gggccttcgcgtttcgtaagatacaggaaagggtcctgcaagggaatgcaaaatgccctt
gatgtcatcacgaatgtccatgaagaatggggtgaactcacaggacgacattatgcacct
ttggttgaggaatacagattagacgatgcggattatgcaatcgtcaccataggcgggatg
accggagccggcaaggatgctgttgatgagatgcgccttgaaggagagaatgtgggtctt
atcaaaatcaaaacctttcgtccctttccccaggaagctttattaaaagctgtttccaag
gttgcggccgtaggtgttgtggatcggtctgttaattttggttggaattccggccctgtt
tatcaggaaatcttagggattctttatcaaatggaaaaaaagattccagcggtcagtttt
attggaggtctggcaggagccgatattaccatcaacgatttcaaagacaccattatgaca
acgaaaagggctttaaatggtgatttgccgaaatcaacaatctggataaatgaatag

DBGET integrated database retrieval system