KEGG   Desulfobacula toluolica: TOL2_C42040Help
Entry
TOL2_C42040       CDS       T02268                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dto  Desulfobacula toluolica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dto00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4986721..4987770
Genome map
AA seq 349 aa AA seqDB search
MKNKPIFPFTAIVGQEEMKLALILNIINPTLSGVLIRGEKGTAKSTAVRALAQILPNIER
VKACPFQLAVNETGTICNACVSTDCPARSDSAILETTLLGISVIELPVGATEDRVVGTMD
LEHALKKGEKRIEPGLLAAAHRGILYVDEVNLLDDHVVDVLLDSAAMGVNTIEREGVSFS
HPARFTLVGTMNPEEGELRPQLLDRFGLCVNIQGALEPEDRVAVMERRAAFDEDPDGFCR
QWENRSQYLSQKIEQAMDLYPRVTIERPLLYEIASFCLDVGVDGHRGDIIILKTAKTLAA
YNGRDQVDSADIERAAELALPHRIRRKPLQEVARDIHAVREQNRGAKAV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaacccatattccccttcacggccattgtgggacaagaagaaatgaagttg
gcattgatactcaatattataaaccccaccttgtcaggcgtactcatcaggggagaaaaa
ggcacggcaaagtccacagcggtaagggccctggctcaaattctgccgaacattgagcgg
gtaaaggcgtgtccgttccaactggccgtaaacgagacaggaacaatctgtaacgcctgt
gtctcaacggattgcccggcccgatccgatagcgcaatacttgaaaccactcttttggga
atcagtgttattgaattgcccgtgggtgccacagaagaccgggtagtgggaacgatggat
ctggaacatgccttgaaaaaaggggaaaaaaggatcgagcccggccttctggcagcggcc
caccggggtattctctatgtggatgaggtgaatctgctggatgaccatgtggtggatgta
ctcctggattccgcagccatgggggtgaacaccattgaaagggaaggtgtttctttttcc
catccggccaggtttacccttgtgggaaccatgaaccctgaagaaggggagttgcggccc
cagctcctggaccgtttcggactctgtgtcaatattcagggcgcgttggagcctgaagac
cgggtggcggtcatggaacggcgtgctgcctttgatgaagacccggacggtttttgccgg
caatgggaaaacaggtcccagtacctgtcccaaaagatcgaacaggccatggatctttat
ccccgggtgaccattgaaagaccgctgctttatgaaatcgcttctttctgcctggatgtg
ggggtagacggtcaccggggggatatcatcatcctgaaaaccgccaagaccctggcggcc
tacaacggccgggaccaggtggattcggcagacattgaacgggccgcagagcttgccctt
ccccacaggatcaggcgcaaacccctccaggaggtggcccgggacattcatgccgtcaga
gaacaaaaccggggggccaaggctgtctaa

DBGET integrated database retrieval system