KEGG   Dictyoglomus turgidum: Dtur_0067Help
Entry
Dtur_0067         CDS       T00800                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0067
   00030 Pentose phosphate pathway
    Dtur_0067
   00051 Fructose and mannose metabolism
    Dtur_0067
   00052 Galactose metabolism
    Dtur_0067
   00500 Starch and sucrose metabolism
    Dtur_0067
   00520 Amino sugar and nucleotide sugar metabolism
    Dtur_0067
  Nucleotide metabolism
   00230 Purine metabolism
    Dtur_0067
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dtur_0067
Enzymes [BR:dtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dtur_0067
    5.4.2.8  phosphomannomutase
     Dtur_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
67303..68730
Genome map
AA seq 475 aa AA seqDB search
MITLDRTIFRMYDIRGEVPKNLNKDVARIIGKAYAIFIRKKTNKDTLTVSVGRDARISSK
ELSEGLIEGLRSSGINVIDIGLCPTPLLYFSLFTLPVDGGIMITGSHNPPQFNGMKICVG
KETIYGPLIQELYEIALNLKDESSLKEGTYETHDIISSYKEFLLKEFQNSAITKLPQGTI
KIVIDSGNGCGGLVAPDVLRKLGVDVIDLFSEPDGNFPNHHPDPTIMETLKTLRETVIKE
KADFGVAYDGDADRIGIIDEKAEVVYGDRLAYIFAKGILKEHPGAKIIGEVKCSKFLFDG
IEKLGGIPVLSPVGHSLIKKKLREENALFAGEMSGHIFFNDRFFGYDDAIYATMRLVELY
AMEKLENPNFVFSDFLKEFPKVYASPEIRVHCSEEKKFEIIKNFFDKLKEKYPDTANKVQ
KVITIDGVRLEFDDGWALARASNTEPVIVLRFEANTEEKLKKYQEMFENIIKEEC
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttagatagaaccatatttagaatgtatgatatccggggagaagttcccaag
aatttgaataaagatgtagcaaggataattggaaaagcttatgcaatatttataagaaaa
aaaaccaataaagacactcttacagtatcggtaggaagagatgcaaggatttcctcaaag
gaactttctgaaggcttaattgaaggtttaagaagctcagggataaatgtgatagacata
ggattgtgcccaactcctcttctctatttttccctttttacccttcctgtagatggagga
ataatgattacaggaagccataatcctcctcaatttaatggcatgaaaatctgtgtggga
aaagagaccatttatggaccattaatccaagaactctatgagattgctttaaaccttaaa
gatgaatcttccttaaaagaaggcacctacgaaactcacgatattatttcctcttacaag
gaatttcttttaaaggaatttcaaaactctgccataactaaacttccccaagggacaata
aagattgtaatagactctggaaatggatgtggaggtcttgtagctcctgatgtcttaaga
aaacttggagtagatgtaatagaccttttctcagaacccgatggaaacttccctaatcat
catccagatccgacgataatggagacattaaaaactttaagagagactgtaattaaagaa
aaggcagattttggggttgcttatgacggagatgcagatagaattggaataatagatgaa
aaagcagaagtggtatatggagataggcttgcttatatctttgctaagggaatattaaaa
gagcatcctggagccaaaattataggagaggtaaaatgttcgaaatttctctttgatggt
atagaaaaattaggaggaattcctgtcctttctcctgtaggacactccttaatcaaaaag
aagttaagagaggaaaatgctctttttgcaggagagatgagtggtcatatattcttcaat
gatagattctttggatatgatgatgctatttatgctactatgaggcttgtagaactctac
gctatggaaaaacttgaaaacccaaatttcgtattttcagactttctaaaagaatttccc
aaggtatatgcatcgccagaaatcagagttcattgcagtgaggaaaagaagtttgaaatt
attaagaatttctttgataaactcaaggagaaatatccggatactgctaataaagtacaa
aaagttataaccatagatggtgtaagattagaatttgacgatggatgggctcttgcaagg
gcaagtaatactgaacctgtgattgtcctaagatttgaagcaaataccgaggaaaaactt
aaaaaatatcaagaaatgtttgaaaacattataaaagaagaatgctaa

DBGET integrated database retrieval system