KEGG   Dictyoglomus turgidum: Dtur_0081Help
Entry
Dtur_0081         CDS       T00800                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
dtu  Dictyoglomus turgidum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dtur_0081
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dtur_0081
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dtur_0081
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dtur_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(80648..83074)
Genome map
AA seq 808 aa AA seqDB search
MLKINIDRDWEYLEENLAFLEHVILRDDWKKVDIPHDIAIEKPRRKDNPSGPDEGFTAGS
NIFYKRNLPIDEELLEKNLILEFEGIMGYSEIYINGILLKKHFYGYSSFLVDITNYVHEG
ENTLLVYVNNTHKPSSRWYAGTGIYRHVWLRVGGEVFIKPWELHVESDILDEKKAFLNIK
VGVKNSSGRKVKAKLQFRIFSKEDELIKESEEKFEIDGKEEKVILKGLEIDNYIPWDIED
PYLYRLEAKILMDDKESDIDSTYFGIRKIEVVPNVGFKLNGRVIKLKGGCIHHDNGILGS
ASYDRAEERKVEILKQNGFNAVRTAHNPFSPSFLDACDRLGMLVMEEFFDVWTAGKRAYD
YHLFFEKYWEEDVENTIKRDFNHPSIIMWSIGNEITWGSGVNWEKEKGYTNIFEWSEKLS
KKVKELDPTRFVTSAFCGLPFEAVKVEDVEEDNTVILGVWKGNEETKSRWGEITEKYFKY
LDVAGYNYKVDRYEDDGKEYPNRIICGTETFPYTLYDNWKETLKNPNVIGDFVWTAMDYL
GEAGIGRASLDENEAKNFLGGFPWLISNCGDIDICGDKKPQSYYRDIVWSLRKVPYIAVL
PPELYGKKIYLRLWGWEPVERNYNFKGWEGKPLRVYVYSDADEVELFLNGKSMGRKIAGD
KVKFKTFYDINYEPGRLEVIGYKDGLEVGRDILETTGEPIKLKLIPDRNRISSCYGDLSY
IKIVAVDEKGREVKNARNKIRVEVEGVGKLVALGSSDPLSQESFVTNEISLYQGRALAIL
KIMGIPGELKLKAWGENLKEEEIVIKCE
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaataaatattgatagagattgggaatatttagaagaaaatttggctttttta
gaacatgttattttaagagatgattggaaaaaggtggatattcctcatgatatagccatt
gaaaaaccaagaaggaaggataatccttcgggacctgatgaggggtttactgcgggaagt
aatattttttataaaaggaatttgcctattgatgaagaacttttagaaaagaatttaatt
ctggaatttgaaggaataatggggtattcagaaatttatataaatggaatccttcttaag
aagcatttttatggatattcaagtttcttggtagatattacaaattatgtgcatgaggga
gaaaatactctgttagtttatgtgaacaatacccataagccaagttctagatggtatgca
ggaactggtatttataggcatgtgtggttgagagtagggggagaggtgtttatcaaacct
tgggagcttcatgtggaaagtgatatcttagatgaaaaaaaggcttttttgaatataaaa
gtgggagttaagaatagcagtggaagaaaagttaaagccaaattgcaatttagaattttc
tcaaaggaagatgaattgataaaggagagcgaagaaaaatttgaaatagatggaaaggaa
gaaaaagttattttaaaaggattagagattgataactatataccctgggatattgaagat
ccttatctttataggcttgaggcaaaaatattgatggatgataaagaatctgatatagat
tctacttattttggtataaggaagattgaggttgtacctaatgtgggctttaaattaaat
ggtagggttattaagcttaaaggtggatgtatacatcatgataacgggattttgggaagt
gccagttatgatagggctgaagaaagaaaggttgagatcttaaaacaaaatggttttaat
gctgtgagaaccgctcataatcctttttctccatcttttcttgatgcctgtgatagattg
ggtatgttggttatggaagagttttttgatgtgtggactgctggtaaaagggcttatgat
tatcatcttttctttgaaaaatactgggaagaagatgtggaaaatactataaagagggat
tttaatcatccttccataattatgtggtccataggcaatgagataacttggggatcagga
gtaaattgggagaaggaaaagggatatacaaatatttttgaatggagtgaaaaactttct
aaaaaggttaaagaattggatcctacgagatttgtaacttctgctttttgtggattgccc
tttgaggctgtaaaggtggaagatgtggaagaagataatactgtaatattgggagtttgg
aaaggcaatgaggaaacaaaaagtagatggggagagataactgagaagtatttcaagtat
cttgatgtggctggatataactataaagtggacagatatgaggatgatggtaaagaatat
cccaatcgtataatttgtggaacagaaacctttccatataccttatacgataattggaaa
gagaccttaaaaaatcccaatgtaattggagattttgtatggactgctatggattatctt
ggagaagctggtattggtagggcatctttggatgagaatgaggcaaaaaactttttggga
ggctttccttggttaatctctaattgtggtgatatagatatttgtggtgataaaaaacct
cagtcctattatagggatatagtttggagcttgagaaaagttccttatatagcagttctt
cctcctgaattgtatggtaaaaagatatatttaagactctggggatgggaacctgtagag
aggaattacaatttcaagggatgggaaggtaaacctttaagggtttatgtgtattctgac
gctgatgaggtagaactatttttgaatggaaaaagtatgggaagaaaaattgctggagat
aaagtaaagttcaagactttctatgacataaattatgaaccgggaagacttgaggttata
ggctataaagatgggttagaagtggggagggatattttggagactacaggagagcctata
aagttaaaattaattcctgacagaaataggatttcatcttgctatggagatttaagctat
ataaaaattgttgctgtggatgagaagggaagagaggtaaagaatgcaagaaataaaata
agagtggaagtagagggagtaggtaaattggtagctcttggaagttccgatcctctttct
caagaaagttttgtgacaaatgaaataagtttatatcagggaagagctcttgccatatta
aaaattatgggaatacctggagagctaaagttgaaagcttggggagagaatttaaaggag
gaagaaatagtgataaagtgtgaataa

DBGET integrated database retrieval system