KEGG   Dictyoglomus turgidum: Dtur_0157Help
Entry
Dtur_0157         CDS       T00800                                 

Definition
(RefSeq) glycoside hydrolase family protein
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00052  Galactose metabolism
dtu00561  Glycerolipid metabolism
dtu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dtur_0157
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dtur_0157
   00600 Sphingolipid metabolism
    Dtur_0157
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dtur_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 7082587
NCBI-ProteinID: YP_002352102
UniProt: B8DYV6
Position
complement(145213..146571)
Genome map
AA seq 452 aa AA seqDB search
MVKIAIIGAGSVSFSMKLLQDLNYYKDLSGSTVVFMDINEERLELVYTLAEKYMKETGAR
LNLEKTTDRKKAIDGADFVINVVKIGGYHNMEKEREIAESLGYYRGFGDRVSDYYGGFAA
YEQLKFIRELAKDVEKLAPNAWYMQVSNPVFEGTNLALRETGLKVVGFCHGYLELFHLIR
VLGLDPKDVEEQVAGFNHSIFLTKFKYKGENAYPLIDKWIEEEAPKLWNSYEYMISPWEY
TQLSPASVEMYRLYGLFPIGDTPRAVSPWWFHTDLNEKKKWYPAGGPDSEIGWTMYLYGL
KLRLAQMERLARDPNVSIVKELPVEESMESIIPFVDAIVNNHRRRLVLNVPNQGAIPGIP
DDVIVEIPVYVDKNGIERERIEKIPSRLMLYVLIPRWLRMERILQAFQEGDRTSLLLMVM
DDPRTKSFEQGKNLVETILSQPWNEEMNKHYK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagattgctattataggtgctggtagtgtttctttctctatgaagcttcttcaa
gatcttaattactataaggatctttctggaagtaccgtggtatttatggatataaatgaa
gagaggttagaactggtttatacccttgcagaaaaatatatgaaggaaacaggggcaaga
ttaaatttagaaaagaccaccgatagaaaaaaggcaatagatggggctgatttcgttatt
aacgtggtaaaaataggtggctatcataatatggaaaaggaaagagagattgcagaaagc
ctgggatactatagagggtttggagatagggtaagcgattattatggcggatttgcagct
tatgagcaattaaaatttataagggagcttgcgaaggatgtagaaaagttagcacctaat
gcttggtatatgcaggtttcaaacccagtatttgagggaacaaacttggccttgagagaa
acaggtttaaaagttgtgggtttctgccatggatatttagagctatttcatcttataagg
gtgcttggtcttgatcctaaggatgtagaggaacaagtagcaggatttaatcattccatt
ttcctcactaaatttaaatataagggagagaatgcttatcccttaatagataaatggata
gaagaggaagccccaaagctttggaattcttacgaatatatgatatctccttgggaatat
actcagctttctccggcgagtgtagagatgtatagactgtatggtctattccccataggg
gatactcccagggcagtttcaccatggtggttccatactgatttaaatgagaaaaagaaa
tggtatcctgcgggaggccctgattctgaaataggttggactatgtatctctatggtcta
aaactgaggcttgctcaaatggagagattagcaagagatcctaatgtctctatagtaaag
gaacttcctgtagaagagagcatggaatccataattccttttgtggatgcgatagttaat
aatcataggcgaaggcttgtattaaatgtacccaaccaaggggcaattccagggattcct
gatgatgtaatagtagagattcctgtatatgtggataaaaatgggatagaaagagagagg
atagaaaaaattccctcaagattgatgctctatgtactcataccgagatggttaagaatg
gaaagaatacttcaagcttttcaagaaggagatagaaccagtttgctacttatggttatg
gatgatccaaggactaagagttttgaacaaggcaagaatttggtagagactattttatct
cagccttggaatgaagagatgaataaacattataaatga

DBGET integrated database retrieval system