KEGG   Dictyoglomus turgidum: Dtur_0259Help
Entry
Dtur_0259         CDS       T00800                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dtu  Dictyoglomus turgidum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dtu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
266190..266792
Genome map
AA seq 200 aa AA seqDB search
MAEKSIFEKLIDELTKLPGIGPKLAQRIAFYLLKQPQESVEVLANTILKVKKEIKYCSIC
FNLTEKDPCEICTNPERDKSIICVVAEPKDLWAIEKTSKFHGVYHVLGGLISPLDGVFPE
DLRIKELMERVKKGNIKEVILATDSTPEGEATAMYIARLLMEYPVKVTRLAHGLPAGTEL
DFADEMTLIHALEGRKELIL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaagtatttttgagaagctcattgatgagctaacaaaacttcctggaatt
gggcccaaattagcccaaagaattgctttttacctcttgaaacaaccacaggaaagtgtg
gaagttcttgcaaacaccatcttaaaggtcaaaaaagagattaaatattgttctatttgc
tttaaccttactgaaaaagatccctgtgaaatctgtacgaaccctgaaagggataaatcc
ataatttgtgtagttgcagagccaaaagatctttgggcaatagaaaaaacctctaagttt
catggagtttaccatgtcctcggaggattaatttctcctttagatggagtatttccagag
gatcttagaataaaagagcttatggaaagggttaaaaaaggaaatataaaagaagttatt
cttgccaccgactctactccagaaggagaagcaactgctatgtatattgcaagacttctt
atggaatatccagtaaaagttacccgtcttgcccatggacttcctgcaggtacagaactt
gattttgccgatgaaatgacccttattcatgccttagaaggaagaaaggagttaatatta
taa

DBGET integrated database retrieval system