KEGG   Dictyoglomus turgidum: Dtur_0260Help
Entry
Dtur_0260         CDS       T00800                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtur_0260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0260
   00020 Citrate cycle (TCA cycle)
    Dtur_0260
   00620 Pyruvate metabolism
    Dtur_0260
   00640 Propanoate metabolism
    Dtur_0260
   00650 Butanoate metabolism
    Dtur_0260
  Energy metabolism
   00680 Methane metabolism
    Dtur_0260
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dtur_0260
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dtur_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
266818..267390
Genome map
AA seq 190 aa AA seqDB search
MKDMLEIRWHARAGQGAKTASYLLAETAMEAGKYIQAFPEYGPERTGAPMKAYTRISDKP
IRIHSQIYNPDVVVVLDKTLIGKVNILEGLPSDGILIVNTTQSPKEIREQLGISDRKIYT
VDATGIALETIGRPIPNTPMLGALIRVVPIISLDEVLNQFRKKFEGRFRPEVVEGNLQAI
KRAYEEVKGE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatgctggaaattcgctggcatgcaagggcagggcaaggagcaaagactgct
tcttatctccttgctgaaacagccatggaggctggaaagtatattcaagcctttccggaa
tatggcccagaaagaacaggagcacctatgaaagcatataccaggatcagcgacaaacct
ataaggatccacagccaaatatataatcccgatgttgtagtagtacttgacaaaactctc
atcggtaaagtgaatattttagaaggacttccatcggatggaatactcatagtaaacact
acccaatctccaaaagagataagagaacagcttggaatctcggacagaaaaatctatact
gtggatgccaccggaatagctcttgaaaccattggaagacctatcccaaatactcccatg
ctgggagccttgattcgtgtagtcccaataataagtttagatgaggtacttaaccagttt
agaaagaaatttgaaggaaggtttagacccgaagttgtggagggtaaccttcaagctata
aaaagagcttacgaggaggtaaagggagaatga

DBGET integrated database retrieval system