KEGG   Dictyoglomus turgidum: Dtur_0334Help
Entry
Dtur_0334         CDS       T00800                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dtur_0334
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0334
  Lipid metabolism
   00071 Fatty acid degradation
    Dtur_0334
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dtur_0334
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dtur_0334
   00626 Naphthalene degradation
    Dtur_0334
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dtur_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
341167..342357
Genome map
AA seq 396 aa AA seqDB search
MKENLNFPYFMPTKIWFGPGSLEKLREEKLPGKKALIVISAGGSMKKLGYLDRLIDILKS
RRVEYVVFDKILPNPIKKHVMEGAQIAREEECDFVIGLGGGSSIDSAKSIALMVKNDGDY
WDYIVGGTGKGKKPEKGALPIVAITTTAGTGTEADPWTVITNEETNEKIGYGNEYTFPTL
SIVDPELMLSVPPHLTAYQGFDAFFHAVEGYIANIANPVSDLYALKSVELIAKYLPICVK
NGNDLIARTYVALANTLSGFVESTSSCTSEHSMEHALSAFHPELPHGAGLIMLSEAYHTF
FASKIPDRYIQLAKVMGLDVDSLPEEEKPYAFIKALKKLQEECGVANLRMSDYGIKEDEI
EKLAQNAIETMGGLFEMDRYKLSFDEVVEILRKAYK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatttgaattttccatattttatgccaactaaaatatggtttggacctgga
agcttagaaaagttaagggaagagaaacttcctggaaaaaaagcacttatagttatctct
gctggaggttcaatgaaaaaacttggttatcttgataggcttatagatatcttaaaaagt
agaagggttgaatatgttgtttttgacaaaattcttcctaatcctattaagaagcatgta
atggagggagcccagattgcaagagaagaagagtgtgactttgttattgggcttggtgga
ggaagcagtattgattcagcaaaaagtatcgcattaatggtaaaaaatgatggagattat
tgggattatattgtaggaggcacaggaaaaggtaaaaaacctgagaaaggtgcgctacca
attgtagctataactaccacagcagggacaggaacggaagcagatccttggactgtaata
accaatgaggaaactaatgaaaagattggatatggaaatgagtatacttttcccacttta
tccattgtagatccagaacttatgttaagtgttcctcctcatcttactgcctatcaagga
tttgatgcctttttccatgcagtagagggatatattgcaaatattgctaatcctgtaagt
gatctttatgctttaaaaagtgtagagttaattgctaaatatttgccaatttgtgttaaa
aatggtaatgatcttattgcgagaacttatgtggctcttgccaatactctttcaggattt
gttgagagtacatcaagctgtacttcggaacattccatggagcatgctctttctgctttt
catccagaacttccccatggagctggtttgattatgctttctgaggcttaccatacattt
tttgcttctaagattcctgatagatatattcaacttgctaaagtaatgggattagacgta
gattctctccctgaagaagaaaaaccttatgcttttattaaagcattgaagaagctacaa
gaagagtgtggagtagcaaatttaaggatgtctgattatggtataaaagaagatgagatt
gaaaaattagctcaaaatgctatagagactatgggaggactttttgaaatggatagatat
aaactaagttttgatgaggtagtggaaatattgagaaaagcatataagtaa

DBGET integrated database retrieval system