KEGG   Dictyoglomus turgidum: Dtur_0384Help
Entry
Dtur_0384         CDS       T00800                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
dtu  Dictyoglomus turgidum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dtur_0384
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dtur_0384
   00600 Sphingolipid metabolism
    Dtur_0384
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dtur_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
389368..390693
Genome map
AA seq 441 aa AA seqDB search
MKISFIGAGSVVFTRNLLRDLALFSEFDETEIALMDIDPERLEVAKKIAEEIKEKKNKNW
NIKGYMDLKSAIENSKYVINTVQIGGKSATYVDFDIPEKYGLKQTIGDTHGIGGIMRFLR
TAPFLRELTRNIEEYAPSALLLNFTNPMSMNQWYINDISEIDTVGLCHSIPYTIEQISSY
VGVPSKEVNYKVAGINHMAWVLVFERNGEDLYPLLFKAMEKKEIWEKDPVRFEILRMFHY
FVTESSEHNAEYVPYFIKDEELVKKLNIPIREYIRRVEENEKVFDAFRDYYLRGNKEAYG
VVKEHYGDEDDDASKEYAIQIIHGIETNNSKLVYSIVRNDGIIDNLPMDCMVEVPCYVDR
NGVSPLKIGYLPDQLASLNLSHINVQRLAVKGAIEGDKDYIHYAALLDPLASSLLSPEKI
HMMVEELLKAHEEYLKDLFRK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagattagttttattggagcaggaagtgtagtatttaccagaaatcttttgagggac
ttggcattattttctgagtttgatgaaacagagatagctcttatggatattgatcctgag
aggttagaagttgcaaaaaagatagcagaggagataaaagaaaagaaaaataaaaactgg
aatattaaaggttatatggatttaaaatctgctattgagaattctaagtatgtgataaat
actgtccaaattggtggaaaatctgctacttatgtggattttgatatacctgaaaagtat
ggcttaaaacagaccattggggatacccatggaattggtggaataatgagatttttgaga
acagcgccatttttaagagagcttactcggaatatagaagaatatgctccttccgcctta
cttttaaactttacaaatcctatgtccatgaatcagtggtatattaatgatatctctgag
attgacacagtgggcttatgccactccataccctatactattgagcaaatttcaagttat
gtgggagttccttctaaggaagtaaattacaaagtagcaggtattaaccatatggcttgg
gttttggtctttgaaagaaatggggaagacctttatccccttttatttaaggctatggaa
aagaaggaaatatgggagaaggatcctgtaagatttgagatactaagaatgtttcattat
ttcgtgaccgagtcttcagaacacaatgcagagtatgttccatactttattaaggatgaa
gagttagttaaaaaacttaatattcccataagggaatatataagaagggtagaagaaaat
gagaaggtttttgatgcctttagagactattatttaagaggaaataaggaggcatatggg
gtagtgaaagaacattatggggacgaagatgatgatgcttcaaaggaatatgctattcaa
attatacatggaatagagacaaataattcaaagcttgtttacagtattgttagaaatgat
gggattatagataatttgcctatggattgtatggtagaagttccatgctacgtagataga
aatggggtttctccattaaaaataggatatctacctgatcaacttgcaagtttaaatctc
tctcatataaatgttcagaggcttgcagtaaaaggtgccatagaaggggataaagattac
atccattatgctgctcttttagaccccttagcttcctctttgctttctccagaaaaaatc
catatgatggtggaagaattattaaaggctcatgaagagtatttaaaagatctttttaga
aagtag

DBGET integrated database retrieval system