KEGG   Dictyoglomus turgidum: Dtur_0424Help
Entry
Dtur_0424         CDS       T00800                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dtu  Dictyoglomus turgidum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dtur_0424
Enzymes [BR:dtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Dtur_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
429927..430595
Genome map
AA seq 222 aa AA seqDB search
MNSEIEKVKRELVKIGKRIAQENLIVGPGGNISAKVGNRVYIKASGISFEDATEDDYIGV
DFNSGEVIEGDKKPSSEIWMHLECYKVREDVKAVVHTHPIYSIAYAFQDEPLKLFTPDMV
ALLGGEIPVVEYVVPGGKEFAGVVGGVIKNHNGVLVKNHGLVTVGSNLKEALYRTLLIEN
SIKTIFVAKLFGKMGFFTKEQIEEIDSLEVEKYRRKLLKEKG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgaaatagagaaggtaaaaagggaacttgtaaaaatagggaaaaggatagca
caggaaaatttaattgtgggacctggaggaaatattagtgcaaaagttggaaatagagtt
tatataaaggcgagcggtatttcttttgaagatgccacagaagatgactatattggtgtt
gattttaattctggcgaagtaattgaaggtgataaaaaaccttcttccgaaatatggatg
catcttgaatgttataaagtaagagaggatgttaaggcagtagtacacacccatcctata
tattcaattgcttatgcttttcaagatgaacctttaaaattattcacacctgatatggtg
gctcttcttgggggagaaattcctgtagtagaatatgtggtgcccggtggtaaggagttt
gcaggagtagttggaggcgttataaaaaatcataatggggtccttgttaaaaatcatgga
ttggtaacagtaggaagtaatctcaaagaagcgctttatagaactctcttaattgagaat
tccataaagacaatatttgtagcaaaattgtttggtaagatgggcttctttacaaaagaa
caaattgaagaaattgacagcttagaggtggaaaaatataggagaaaactactaaaagaa
aaaggttga

DBGET integrated database retrieval system