KEGG   Dictyoglomus turgidum: Dtur_0433Help
Entry
Dtur_0433         CDS       T00800                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dtu  Dictyoglomus turgidum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dtur_0433
   00500 Starch and sucrose metabolism
    Dtur_0433
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Dtur_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
439114..440487
Genome map
AA seq 457 aa AA seqDB search
MEIKNIILLLTLILLLIITGCSAKESNLVFNVTVLNPPSSVVIDNPYTLNLISTQDAFVT
VYLNDNIVFENYPIKANSTQSINISFSKSRGNNIRVEVRNRNQEKYEYAYENVLYLPKVD
IVVDKNYTGEDGTEINGRKYFKSVLKAMVYITLNQSAYSGRRVYVFIKSGDYYEKVNIMS
PNISLIGEDVNTTRIYYDLAAGSPGAGGTSGSASVTIAGSATGFTAENITFENAFDEIAN
ANISSKQAVAVLSQSDKAVFKNCRFIGNQDTLYVRGGIHYFVDCYIEGDVDFIFGDGRAV
FEKCVIFSVDRAGITPKGYVTAASTKIGNLGFLFTNCELKTNINEEGSVYLGRPWHPSSD
PYSVNSNVVLRNCYMDKHIHPDGWTAMSSKDPNTGETIWFYPDTERFYEYENYGPGAIIN
DKRRQLTGDDVNYYTKENYLGGWDVESFIKNLYEAPN
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaaaatataatattgcttttgactcttatacttttgttgattattactggt
tgttctgcaaaggaaagtaaccttgttttcaatgttacagttttgaatcctccatcttct
gtagttattgataatccctatactctaaacctgatttctactcaagatgcttttgtgact
gtctaccttaatgataacatagtttttgagaactatcctattaaagccaatagtactcaa
agtattaacatatctttttctaaatctcgtgggaacaatattagggttgaagtaagaaac
agaaatcaagagaaatacgaatatgcctatgaaaatgttttgtatctccctaaagtagac
attgtggtagataaaaactatacaggagaagatggtacagagatcaacggtagaaagtat
ttcaagagtgtcttaaaagcaatggtttatataactctgaatcaatctgcatattctgga
agaagagtttatgtatttattaaaagtggagattattatgaaaaagtaaatataatgtct
cctaatatcagccttattggtgaagatgtgaataccacaaggatatattacgatcttgca
gcaggatctcctggagctggtggaacatcaggcagcgccagtgtaactattgcaggtagt
gctactggttttactgcggaaaatattacttttgaaaatgcctttgatgagattgctaat
gcaaatatatccagtaaacaggcagtagcagtattatcccaatctgacaaagctgtgttt
aagaactgtagatttattggtaatcaagataccttgtatgtgaggggtggaattcattac
tttgtagattgctatattgaaggagatgtagatttcatatttggtgatggtagagcagtt
tttgagaaatgtgtaatattctccgtagatagagcaggaattactccaaaaggttatgtc
actgctgcaagtacaaaaataggcaatttgggattcttatttactaattgtgaactgaaa
acaaatataaatgaagaaggttcagtttatcttggtcgtccttggcatccaagctcagac
ccttatagtgtgaattctaatgtggttcttagaaactgttatatggataagcatattcat
cctgatggttggactgccatgagctctaaagatcctaatactggtgagactatatggttc
tatccggatactgagagattttatgagtatgaaaattatggaccaggagcaataataaat
gataagagacgtcagcttacaggagatgatgtaaactattacactaaagaaaactatctt
gggggatgggacgtggaaagctttattaagaatttatatgaggcccctaattaa

DBGET integrated database retrieval system