KEGG   Dictyoglomus turgidum: Dtur_0505Help
Entry
Dtur_0505         CDS       T00800                                 

Definition
(RefSeq) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dtur_0505
Enzymes [BR:dtu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dtur_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase LBP_M Glyco_hydro_2_C Glyco_hydro_14 DUF4434
Motif
Other DBs
NCBI-GeneID: 7083167
NCBI-ProteinID: YP_002352412
UniProt: B8E215
Position
complement(510161..512212)
Genome map
AA seq 683 aa AA seqDB search
MINPKLPYIWYGGDYNPEQWDKEVWKEDVRLFKLANINIATVNVFSWALLQPSEDIYDFS
MLDEIINNLWENGIHICLATSTASQPHWMSVKYPEILPVDINGHKREHGGRVNFCPNSKI
YRYFAGKLVEKLAERYANHPGIVAWHIANEYGTYCFCENCVKEFRDWLKKKYGTLEELNK
RWYTTFWSQTFYDWNEINAPTLRSVMFHHWWTGKLSTVAQGMVLDYYRFMSESILECYLN
EYNIIKKYNPNIPVTTNLMGAFKPLNYFEWAKHMDVVSWDSYPYLTDDYVNIAFRHSLMR
GLKQGEPFMLMEQTPSQTNWQPYCYIKRPKVMRLQSYQAIAQGADTVMFFQLRQSRGGPE
KFHGAVISHAGHENTRVFKEVKELGEELKKLGDTILGSRVKSQTAVVFDWENWWALENSQ
GPSTAINYVEGVEKYFRAIFENTLGVDVIGVEDNFEKYKLIVAPLLYMVKEEWAEKIKNY
VRKGGIFITTTLSGLVNENDLVYIGGYPKPLRDVLGIWVEEFDALPPEMKNEIIIQDEFK
KEFSKEKYECNLVFDVIHLESNNAKAIGVYSKDYYQGYPCITVNKYGEGYAYYIGTFPSK
DFLKEFVKYLSKTHNIEPILKDVPYGLEITQRVKDGKTFTFVLNHTEEIKTINIGSKRKD
LLSGKEFEGLIDIHPREVLILEG
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgataaatccgaaactgccctacatttggtatggtggagactacaatcctgagcaatgg
gacaaagaagtatggaaagaagatgtaagactttttaagcttgcaaacataaatattgcc
acagtgaacgttttctcctgggcacttttacaaccatcagaagatatatatgacttctct
atgcttgatgaaatcataaacaatttatgggaaaatggtattcatatatgtcttgcaact
tcaacagcttctcaaccccattggatgtcggtaaaatatcctgaaattcttcctgtggac
attaacgggcataagagagaacatggaggaagagtaaatttttgtcctaacagcaaaata
tataggtattttgcaggaaaacttgtagaaaaacttgccgaaagatatgctaaccatcca
ggaatagtagcatggcatatagctaacgaatatgggacttattgtttctgtgaaaattgt
gtgaaggaatttagagattggctaaaaaagaaatatggaaccttagaagaacttaacaaa
agatggtacactaccttctggagtcagaccttttatgattggaatgagattaatgcacct
actctaagaagcgtaatgtttcatcattggtggacaggaaaattatccacagtagcccaa
ggaatggttcttgattattatcgctttatgtcggaaagtatcttagaatgttatctcaac
gaatacaatatcatcaaaaaatataaccctaatatacctgtaaccacaaatcttatgggt
gcctttaaaccccttaattactttgaatgggcaaaacatatggatgtagtttcctgggat
agttatccataccttaccgatgattacgtaaacatcgcctttaggcactcccttatgagg
ggattaaagcaaggtgaaccctttatgcttatggaacaaaccccaagccaaactaactgg
caaccttactgctatataaaaaggccaaaagtaatgaggcttcagagctatcaggccata
gcacaaggagcagatactgtaatgttctttcagttaagacaatcaaggggtggaccagaa
aaattccatggtgcggtaatatctcatgcaggacacgaaaatacaagggtttttaaagaa
gtaaaagaattaggggaagaacttaaaaaattaggagatactatccttggaagtagagta
aaatctcaaacagcggtagtttttgattgggaaaattggtgggctcttgaaaattctcaa
ggtccaagtactgccataaattatgtagaaggagttgaaaaatattttagagccatcttt
gaaaataccttaggggtggatgtgataggagtagaagacaactttgaaaaatataaatta
attgttgctcctcttttatatatggtaaaagaagaatgggcagaaaaaataaagaattat
gttagaaaaggtggaatttttataaccacaaccttaagtggacttgtaaatgaaaatgat
ttagtttatattggtggatatcctaagcctttaagagatgttcttggaatttgggtagaa
gaatttgatgcccttcctcctgaaatgaaaaatgaaattataatacaagatgagttcaaa
aaagaattttcaaaagaaaagtatgaatgcaatttagtatttgacgtaattcacttggaa
agtaataatgctaaagccattggagtttacagtaaagattattatcaaggatatccgtgt
ataacggtaaacaaatatggggaaggatatgcgtactatattggcacattcccatcgaag
gattttttgaaagaatttgtaaaatatttatcaaaaacacataatatagagcctatctta
aaagatgttccatatggattagaaataactcaaagggtaaaagatggaaaaacttttacc
tttgtactaaaccacacggaagaaataaaaactataaatataggttctaagagaaaagat
ttactttcaggaaaagaatttgaaggcttaattgatattcacccaagagaggttttaatc
cttgaggggtaa

DBGET integrated database retrieval system