KEGG   Dictyoglomus turgidum: Dtur_0630Help
Entry
Dtur_0630         CDS       T00800                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dtur_0630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0630
  Lipid metabolism
   00071 Fatty acid degradation
    Dtur_0630
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dtur_0630
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dtur_0630
   00626 Naphthalene degradation
    Dtur_0630
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dtur_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(635051..636085)
Genome map
AA seq 344 aa AA seqDB search
MKMKAMLLKEIKNLSIDRNPLTLEEIEVPTPKEKEILIEVYACGVCRTDLDIIEGRTLPS
KFPIILGHQIVGRVVEKGKNANKFSIGERVGIAWINSSCGKCKYCLSGQENLCDEFKATG
RDVDGGYAEYTVVSEDFAYKIPENYSDEESAPLLCAGAVGYRSLKLTNIKDGDNIGLSGF
GASGHLVLKMIKFLYPSSKIFVFARSKEERNFAKELSAYWTGDFDEDPPEKLKAIIDTTP
AWKPIISVLKNLEKGGRLVINAIRKEEGDKEFLLNLKYERDLWMEKEIKSVANVTRKDVE
EFLKIAEKLNFKPEIQIYPLEEANKALLELKEGKIRGAKVLKIR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaggcgatgcttttaaaagagataaaaaatctatccatagacagaaatcct
ctaacccttgaggaaatagaagttccaaccccaaaggagaaagaaatattaatagaggta
tatgcatgcggagtttgcagaaccgatttagatattattgaaggaagaactcttccatca
aaatttcccataatcttaggacatcaaatcgtgggaagagttgtggaaaagggtaaaaat
gcaaataaattttccattggagaaagggtaggtattgcatggataaattcttcttgtgga
aagtgtaaatattgcttatcagggcaagaaaatctatgcgatgaatttaaggctacagga
agagatgtggatggaggatatgcagagtatacagtggtttcagaagattttgcatacaag
attcctgagaattattccgatgaagaatcggctccccttctttgtgcaggtgctgtagga
tatagatctttaaaactcaccaacataaaagatggagataatattggactttctggattt
ggagcatcgggacacttggtattaaaaatgataaaatttctctatcctagttcaaaaatt
tttgtctttgcaagaagcaaagaagaaagaaattttgcaaaggaactttcagcttattgg
acaggagatttcgatgaagatcctcctgaaaaactaaaagccataatagacactactcca
gcatggaagcccataatttcagtactaaaaaaccttgaaaaaggtggaagattggtgata
aatgccataagaaaggaagagggagataaagaatttcttttgaacttaaaatatgaaaga
gatctttggatggaaaaggaaataaaaagtgtagccaatgtaacaagaaaagatgtagag
gaatttttaaagatagcagaaaaactaaattttaaacctgagattcaaatatatcccttg
gaagaagctaataaagcccttcttgagctaaaagaaggaaaaattagaggggcaaaggta
ttgaaaataagatga

DBGET integrated database retrieval system