KEGG   Dictyoglomus turgidum: Dtur_0630Help
Entry
Dtur_0630         CDS       T00800                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dtur_0630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0630
  Lipid metabolism
   00071 Fatty acid degradation
    Dtur_0630
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dtur_0630
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dtur_0630
   00626 Naphthalene degradation
    Dtur_0630
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dtur_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(635051..636085)
Genome map
AA seq 344 aa AA seqDB search
MKMKAMLLKEIKNLSIDRNPLTLEEIEVPTPKEKEILIEVYACGVCRTDLDIIEGRTLPS
KFPIILGHQIVGRVVEKGKNANKFSIGERVGIAWINSSCGKCKYCLSGQENLCDEFKATG
RDVDGGYAEYTVVSEDFAYKIPENYSDEESAPLLCAGAVGYRSLKLTNIKDGDNIGLSGF
GASGHLVLKMIKFLYPSSKIFVFARSKEERNFAKELSAYWTGDFDEDPPEKLKAIIDTTP
AWKPIISVLKNLEKGGRLVINAIRKEEGDKEFLLNLKYERDLWMEKEIKSVANVTRKDVE
EFLKIAEKLNFKPEIQIYPLEEANKALLELKEGKIRGAKVLKIR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaggcgatgcttttaaaagagataaaaaatctatccatagacagaaatcct
ctaacccttgaggaaatagaagttccaaccccaaaggagaaagaaatattaatagaggta
tatgcatgcggagtttgcagaaccgatttagatattattgaaggaagaactcttccatca
aaatttcccataatcttaggacatcaaatcgtgggaagagttgtggaaaagggtaaaaat
gcaaataaattttccattggagaaagggtaggtattgcatggataaattcttcttgtgga
aagtgtaaatattgcttatcagggcaagaaaatctatgcgatgaatttaaggctacagga
agagatgtggatggaggatatgcagagtatacagtggtttcagaagattttgcatacaag
attcctgagaattattccgatgaagaatcggctccccttctttgtgcaggtgctgtagga
tatagatctttaaaactcaccaacataaaagatggagataatattggactttctggattt
ggagcatcgggacacttggtattaaaaatgataaaatttctctatcctagttcaaaaatt
tttgtctttgcaagaagcaaagaagaaagaaattttgcaaaggaactttcagcttattgg
acaggagatttcgatgaagatcctcctgaaaaactaaaagccataatagacactactcca
gcatggaagcccataatttcagtactaaaaaaccttgaaaaaggtggaagattggtgata
aatgccataagaaaggaagagggagataaagaatttcttttgaacttaaaatatgaaaga
gatctttggatggaaaaggaaataaaaagtgtagccaatgtaacaagaaaagatgtagag
gaatttttaaagatagcagaaaaactaaattttaaacctgagattcaaatatatcccttg
gaagaagctaataaagcccttcttgagctaaaagaaggaaaaattagaggggcaaaggta
ttgaaaataagatga

DBGET integrated database retrieval system