KEGG   Dictyoglomus turgidum: Dtur_0643Help
Entry
Dtur_0643         CDS       T00800                                 

Definition
carbohydrate-binding family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
dtu  Dictyoglomus turgidum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
646791..647438
Genome map
AA seq 215 aa AA seqDB search
MRRSRLFILITLLVIGLFLSLAFGQTLTATAKYGKPKIDAEMDEVWKNAEEYITDRYVQG
VKGKVAYAKFRVLWDEESIYVWAEVYDSLLNKDSTNPWEQDSLEIFVDEGNEKATSYDKN
DAQYRVNFENVQSYGTNASRDYFVTATKKTDFGYIVEAQVKMRTRKLNEGDVIGFDVQVN
DADRFGSRVGIIAWNETENENWRNPSYLGNLKLVK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaggtcaagactttttatcctcattactcttttggttatcgggcttttcctatcc
ttagcttttggtcaaactttaactgctactgctaaatatggtaaacctaagattgatgca
gagatggacgaggtttggaaaaatgccgaggaatatattactgatcgttatgtacagggg
gtaaaggggaaggtagcatatgctaaattcagagtactctgggacgaagaaagtatatat
gtttgggctgaagtgtatgattcacttctaaataaggatagtacgaatccatgggaacaa
gattctttagaaatatttgtagatgagggtaatgaaaaagcaacctcttacgataaaaat
gatgctcagtacagggtaaattttgagaatgtacaaagttatggtactaatgcttcccgt
gattactttgtgacagctacaaaaaagactgactttggctatattgtagaggcgcaagta
aagatgagaacaagaaaacttaacgagggagatgtaattggatttgacgtgcaagtaaac
gatgctgataggtttggaagcagagttggaattattgcatggaatgagactgagaatgaa
aactggagaaatccatcctatcttgggaatttaaaacttgtgaagtga

DBGET integrated database retrieval system