KEGG   Dictyoglomus turgidum: Dtur_0670Help
Entry
Dtur_0670         CDS       T00800                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dtu  Dictyoglomus turgidum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dtu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
677738..678676
Genome map
AA seq 312 aa AA seqDB search
MNNLPIKRGINFGDALEAPYEGAWSGYIIKDEYFKIVKDAGFDHVRIPIKWSVYTQKEAP
YSIEKRIFDRVDHLIEEGLKNNLHVIINIHHYEEIMEDPLGEKERFLAIWRQISEHYKDY
PNNLYFELLNEPTQNLSSELWNQFLKEAIEVIRRTNPERKIIVGPDNWNSLYNLEKLIIP
ENDENIIITFHYYNPFPFTHQGAGWVKIDLPVGVKWLGTEEEKREIERELDMAVSWAEEH
GNIPLYMGEFGAYSKADMESRVRWTDFVARSAEKRGIAWSYWEFYSGFGVFDPEKNEWRT
PLLRALIPERNI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcttcctattaagagaggaattaattttggggatgctttagaagctccttat
gagggggcttggagtggttatataattaaggatgaatattttaaaattgttaaagatgca
ggttttgatcatgtaagaattcccataaagtggagtgtttatactcaaaaagaagcccca
tattctattgagaaaagaatttttgacagagtggatcatttaatagaagaaggacttaaa
aataatctccatgttattataaacattcatcattatgaagagataatggaggatccctta
ggggaaaaagaaagatttctagctatatggagacagatttctgaacactacaaggattac
cctaataatctttattttgaacttttaaatgagcctactcaaaatctgagtagtgaatta
tggaatcagtttttaaaagaggctattgaagttataaggagaacgaatcctgaaaggaag
attattgtaggaccagataattggaatagtttatataatcttgagaaattgataattcca
gaaaatgatgagaatatcataattacttttcattattacaatcctttcccttttactcat
cagggggcagggtgggtaaaaattgatttacctgtaggagtaaaatggttaggtactgag
gaagagaaaagggaaatagaaagagaacttgatatggcagtaagttgggcagaagagcat
ggcaatatacccctttatatgggggagtttggagcatattcaaaggcagatatggagtca
agggtaaggtggacagattttgtggcaagatctgcagaaaaaagaggtattgcttggtca
tattgggaattttattctggatttggagtgtttgatcctgagaaaaatgaatggagaacg
cctcttcttagggcattaatacctgaaaggaatatatga

DBGET integrated database retrieval system