KEGG   Dictyoglomus turgidum: Dtur_0680Help
Entry
Dtur_0680         CDS       T00800                                 

Definition
(RefSeq) peptidase M42 family protein
Organism
dtu  Dictyoglomus turgidum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(691133..692143)
Genome map
AA seq 336 aa AA seqDB search
MKELIKKLTEIKSPSGREENIRSAILEELKEYIDGYEIDKLGNLIVWKKGKKEGKILLDA
HMDEIGVLATHIDEKGFIRIEPIGGVSPYNLLGSSIAFPNIEGFVGVEGETSEELSKNLK
NLDFDKIFVDIGAKNKLEAEKLVPPGTFGVYSASFKDLGERIVSKAMDDRIGCAIIIEVF
KKSNPYYTLYGTFSIQEEIGLVGASVVAFNIKPDLAIAVDVTAHSDTPKGPKRMSLELGK
GPAIKIKDSASISDRRIVEKLKNIAERNNIPYQIEILLRGGTNAAALQRTGEGIPAGTLS
IPTRYVHSPHEMVDIKDVENAVKILKLLVESEESLF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacttatcaaaaaattaacagaaataaaatctccaagtggtagagaagaaaat
ataagaagtgcaatccttgaagaattaaaagaatacattgatggctatgagatagataaa
ctcggaaacttaatagtttggaaaaaaggaaaaaaagaaggaaaaatacttcttgatgct
catatggatgagattggagtccttgccactcatatcgatgaaaaaggatttatcagaata
gaacctatcggaggagtttctccttataacttgttaggaagtagcatagcatttccaaat
atagaaggatttgtaggagttgaaggagaaacttccgaggaactttcaaaaaacctcaaa
aatcttgattttgataaaatctttgtagatattggagcaaaaaataaattagaagcagaa
aagcttgttccaccaggaacctttggagtttactcagcaagctttaaagacttaggagaa
agaattgtatctaaagccatggatgaccgaattggatgtgctataataattgaagttttc
aaaaaatctaatccttactataccctttatggaaccttttctattcaagaagaaatagga
cttgtaggagcaagtgtggttgcctttaatataaaaccagatcttgccatagctgttgat
gttacagcccactctgatactcctaaaggaccaaaaagaatgtccctcgaattaggaaaa
ggacctgccataaaaataaaagacagcgcatctattagtgatagaagaatagttgaaaag
ttgaaaaatatagcagaaaggaataatatcccttaccaaattgagattctacttcgtggt
ggtaccaatgctgctgctctacaaaggacaggagaaggaattcctgcaggaaccttatct
atacctacaagatatgtgcattcaccccatgaaatggtagacataaaagacgtagaaaat
gcagttaaaatattaaaactcttagtagaaagtgaagaaagccttttttaa

DBGET integrated database retrieval system