KEGG   Dictyoglomus turgidum: Dtur_0681Help
Entry
Dtur_0681         CDS       T00800                                 

Definition
(RefSeq) cellulase (EC:3.2.1.4)
Organism
dtu  Dictyoglomus turgidum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(692145..693143)
Genome map
AA seq 332 aa AA seqDB search
MFLKELSDIPGVSGFEGKVREFIKEKIKDKVDYIETDKLGNLIALKKGKVNKKLMITAHM
DEVGFIVSNIEEDGKISIIPLGTIDPRVVLGKKVVIGEKQILGVIGSKPVHLMEGYEKVS
FENIKVDIGATKKQEAESKVKIGDFVSFAPNAMVHEEWISGKALDDRGGCSILMDLILSG
LDLYYDTFFAFVIQEETGLRGSGSCAFKINPDFAIVVETTTSGDNPEFPPDRRSSELGKG
PVITPAHRGYVNDERLFNFAVKVAKENNIPYQIKRRTVGGTDAARIAITTGTPSLVISIP
SRYIHSPMSVVNISDYQNTLKLLSLILIKEVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaaaagaactttcagatatacctggggtttctgggtttgagggaaaagtaaga
gaatttattaaagaaaagataaaagataaagtagattatatagagacagacaaattagga
aaccttatagctcttaaaaaaggtaaagtaaataaaaaacttatgattaccgcccacatg
gatgaagtagggtttattgtaagtaatattgaagaagatggaaagataagcataatacct
ttagggaccattgatccaagagtagtcttagggaaaaaggtagtaataggagaaaaacag
atattgggagttataggttcaaaacctgtacaccttatggagggatacgaaaaagtatcc
tttgagaatataaaagtagatattggagccacaaaaaaacaagaggctgaatcaaaagta
aaaattggtgattttgtaagttttgcgccaaacgccatggtacacgaagaatggatatct
ggaaaagcccttgatgatagagggggatgttcaattctcatggacttaatcctttcaggt
ttagatctatattacgacacattttttgccttcgtaatacaagaagaaacaggactgaga
ggctctggctcttgtgcctttaagataaaccctgattttgcaattgtggtagaaaccacc
acttcgggggataatccagaattccctcctgacagaagatcttcagaacttggaaaagga
cctgttattacacctgcccataggggatatgtaaacgatgaaagattatttaactttgcg
gtaaaagtagcaaaagaaaataacatcccctatcaaataaaaagaagaactgtagggggt
actgatgcggcaagaatagccataactacaggtacaccatccttagttatatctattcct
tccagatatattcactcccccatgagtgtagtaaatattagtgattatcaaaatactcta
aagcttctttccctaattcttataaaggaggtcttataa

DBGET integrated database retrieval system