KEGG   Dictyoglomus turgidum: Dtur_0681Help
Entry
Dtur_0681         CDS       T00800                                 

Definition
(RefSeq) cellulase
Organism
dtu  Dictyoglomus turgidum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 DUF1347
Motif
Other DBs
NCBI-GeneID: 7083343
NCBI-ProteinID: YP_002352580
UniProt: B8DZN3
Position
complement(692145..693143)
Genome map
AA seq 332 aa AA seqDB search
MFLKELSDIPGVSGFEGKVREFIKEKIKDKVDYIETDKLGNLIALKKGKVNKKLMITAHM
DEVGFIVSNIEEDGKISIIPLGTIDPRVVLGKKVVIGEKQILGVIGSKPVHLMEGYEKVS
FENIKVDIGATKKQEAESKVKIGDFVSFAPNAMVHEEWISGKALDDRGGCSILMDLILSG
LDLYYDTFFAFVIQEETGLRGSGSCAFKINPDFAIVVETTTSGDNPEFPPDRRSSELGKG
PVITPAHRGYVNDERLFNFAVKVAKENNIPYQIKRRTVGGTDAARIAITTGTPSLVISIP
SRYIHSPMSVVNISDYQNTLKLLSLILIKEVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaaaagaactttcagatatacctggggtttctgggtttgagggaaaagtaaga
gaatttattaaagaaaagataaaagataaagtagattatatagagacagacaaattagga
aaccttatagctcttaaaaaaggtaaagtaaataaaaaacttatgattaccgcccacatg
gatgaagtagggtttattgtaagtaatattgaagaagatggaaagataagcataatacct
ttagggaccattgatccaagagtagtcttagggaaaaaggtagtaataggagaaaaacag
atattgggagttataggttcaaaacctgtacaccttatggagggatacgaaaaagtatcc
tttgagaatataaaagtagatattggagccacaaaaaaacaagaggctgaatcaaaagta
aaaattggtgattttgtaagttttgcgccaaacgccatggtacacgaagaatggatatct
ggaaaagcccttgatgatagagggggatgttcaattctcatggacttaatcctttcaggt
ttagatctatattacgacacattttttgccttcgtaatacaagaagaaacaggactgaga
ggctctggctcttgtgcctttaagataaaccctgattttgcaattgtggtagaaaccacc
acttcgggggataatccagaattccctcctgacagaagatcttcagaacttggaaaagga
cctgttattacacctgcccataggggatatgtaaacgatgaaagattatttaactttgcg
gtaaaagtagcaaaagaaaataacatcccctatcaaataaaaagaagaactgtagggggt
actgatgcggcaagaatagccataactacaggtacaccatccttagttatatctattcct
tccagatatattcactcccccatgagtgtagtaaatattagtgattatcaaaatactcta
aagcttctttccctaattcttataaaggaggtcttataa

DBGET integrated database retrieval system