KEGG   Dictyoglomus turgidum: Dtur_0695Help
Entry
Dtur_0695         CDS       T00800                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtur_0695
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtur_0695
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtur_0695
Enzymes [BR:dtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtur_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
705586..706791
Genome map
AA seq 401 aa AA seqDB search
MRKIDFKNLPDERGYFGEFGGRFVPETLMEPLLQLEEAYNKYKDDEEFKKELGYYLKTYV
GRPTPLYFAKNLSERLNAKIYLKREDLCHTGAHKINNAVGQALLAKYMGKRRLIAETGAG
QHGVATATVAALFGFQCTVYMGEEDCERQKINVLRMKLLGAEVVPVKVGSRTLKEAINEA
LRDWVAHPEDSYYLLGSVVGPHPYPIIVRDFQKIIGEEAKNQILEIEGRLPDYLIASVGG
GSNSIGLFYPFLEEDVKIIGVEGGGKGLGSGLHSASINFGKVGVLHGAKMYLIQDENGNV
SPTHSISAGLDYPGVGPEHSFLAQIGRVKYDIATDDVALKGFLTLSELEGIIPALESAHA
IGYVIEHRKDFPEEEPIIIINLSGRGDKDLGIIINYMGEKE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagactttaaaaatcttcccgatgagagaggatactttggagaatttgga
ggaaggtttgttcctgagactttaatggaaccattacttcagttagaagaagcttataat
aaatacaaagatgatgaagaattcaaaaaggaattaggttattatcttaaaacctatgtg
ggaagaccaactcctctctattttgcaaaaaatctctcagaaaggctaaatgcaaagata
tacctaaagagagaagacttatgccatacaggagctcacaaaataaacaatgctgtagga
caagcactacttgctaaatacatgggaaaaaggagactaatcgcagagacgggtgcagga
caacatggtgttgctactgctactgtagctgcactttttggttttcagtgcacagtttat
atgggagaggaagattgtgaaagacaaaagattaatgtcctaaggatgaaactcttaggt
gcagaagtagttcctgtaaaggttggttcaaggactttaaaagaagcaataaatgaggca
ttgagggattgggtagcacatcctgaagatagttattatcttttgggatcagtagttggt
cctcatccttatcccattattgtaagggattttcaaaaaataataggcgaagaagccaag
aatcagatattagagatagaaggaagacttcctgattatttgatagcctccgtaggagga
ggaagcaattctataggacttttttatccttttcttgaggaagatgtaaagataatagga
gttgagggaggaggaaaggggttaggatctggcttacattctgcaagcataaattttgga
aaagtaggggttcttcacggggctaagatgtatcttatacaagacgaaaatgggaatgtt
tctcctactcattccatatctgctggtttggattatcctggggtgggtcctgaacatagt
ttccttgctcagattggaagagtaaaatacgatatagctactgatgatgtggcattgaag
ggttttttgactctttcggagttggagggaattattcctgctcttgagagtgctcatgcc
ataggatatgtaatagagcatagaaaagattttcctgaagaagaacctattataataatc
aacctttcgggaagaggagacaaggatttaggaataataataaattacatgggggagaaa
gaatga

DBGET integrated database retrieval system