KEGG   Dictyoglomus turgidum: Dtur_0696Help
Entry
Dtur_0696         CDS       T00800                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtur_0696
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtur_0696
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtur_0696
Enzymes [BR:dtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtur_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
706788..707549
Genome map
AA seq 253 aa AA seqDB search
MSNLLEKFKNKSKSLFFIPFFVSGFPSFDFLEVFLLKNKDKIDILELGVPFSDPVADGPV
LQEINYRAMVRGVNLNSTLDWLVRSGVSRNIDVILLLYFNLIQNKLEENLKRFKDTEIKG
LVIPDLPMEEAETLIPLFNKYNLDLILFISPTTRDERMKKILKMAPSFLYCISVKGVTGE
RDKLPEEGVSFISRIKKETDKPLVWGFGLSNSSQIAALKGLVDGVIVGSAIGKRLLNNED
IQEYFDELYRATL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttattagaaaaattcaaaaataaaagtaaatctctattttttattcccttt
tttgtttcaggatttcccagttttgattttttggaggtttttttattgaagaacaaggat
aagattgatatacttgagcttggggttcctttttcggatccagtggctgatggtcccgtt
ttacaggagataaattacagggcgatggtaaggggagtaaatttaaatagtactcttgat
tggcttgtgaggtcgggagtttcgagaaatattgatgttattcttctactttattttaat
ttaattcagaataagcttgaagagaatctgaaaagattcaaggatacggagattaaagga
ttagttatacctgatcttcctatggaagaggcagaaactttaattcctctatttaataaa
tataaccttgatcttattctttttatttctcctaccacaagggatgaaaggatgaaaaag
attttaaaaatggctccaagttttctttattgtatctctgtcaaaggagtgacaggagaa
agagacaaacttcctgaagagggagtgtcttttataagtaggattaaaaaagaaactgat
aaacctcttgtttggggttttggtttaagtaatagttctcaaatagctgctttaaaaggc
ttagttgatggagtaattgtgggaagtgctatagggaagagacttttaaataatgaggat
attcaggaatattttgatgagctttatagagctacattatga

DBGET integrated database retrieval system