KEGG   Dictyoglomus turgidum: Dtur_0834Help
Entry
Dtur_0834         CDS       T00800                                 

Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00330  Arginine and proline metabolism
dtu00332  Carbapenem biosynthesis
dtu01100  Metabolic pathways
dtu01130  Biosynthesis of antibiotics
dtu01230  Biosynthesis of amino acids
Module
dtu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dtur_0834
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Dtur_0834
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dtur_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Skp1
Motif
Other DBs
NCBI-GeneID: 7082786
NCBI-ProteinID: YP_002352729
UniProt: B8E032
Position
855863..856978
Genome map
AA seq 371 aa AA seqDB search
MNNWKRIVVKVGTSSITDGRGSPSGEKILSLVKECVKLIRADKELVLVSSGAIASGREII
QKLSKRKDLPAKQALSAVGQVRLMQYYSQLFSIFKQPIAQILLTAEDLRDRKRYINISQT
FETLLEEKIIPIVNENDTVAVEEIKIGDNDTLSAKVACAINADLLVILSDVEGLYSEDPN
ISSNALLITDVYEIDESIEKIAGPGKGTGGMFTKVQAAKIVTEAGIPMILARADVENILE
RIVLKKEKVGTFFYPSEKHLNKRKHWMLFMAKPEGRIYIDDGAKDALLKRGKSLLPVGIK
KVEGEFTRGDTVSIFDLRGEEIARGITNYDSLELDKIKGKNTEEIRNILGEDFYEEVIHR
NNLVLTNRGDL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaataattggaaaagaattgtagtaaaagtaggtacttcaagtattaccgatggaaga
ggaagcccttctggggagaaaattttgtccttagttaaggagtgtgtaaagcttataagg
gcagataaagaattagttcttgtgtcctcgggtgctatagcttcgggaagagagattata
caaaagctctctaaaaggaaagatcttcctgcaaagcaggctctttctgcagtaggacaa
gtaagattgatgcagtattactctcagcttttttctatctttaagcaacctattgctcaa
atccttcttactgcagaagatcttagagatagaaagaggtatataaacatttctcaaacc
tttgagacattgttagaagaaaaaattatccctatcgtaaatgaaaatgataccgtagct
gtcgaggaaataaaaataggtgacaacgatactctttctgcaaaggtagcttgtgctatt
aatgctgatcttcttgtaattttatctgatgttgagggtttatattcagaagacccaaat
atttcatcaaatgcattactgataactgacgtatatgaaattgacgagagtatagagaaa
atagctggtccagggaaaggtacaggaggaatgtttactaaagtacaggctgctaaaata
gtaaccgaagctggcattcctatgattcttgccagagctgatgtggaaaatatccttgaa
agaattgttttaaagaaagaaaaagttggaaccttcttttatccatcagaaaaacattta
aacaaaagaaagcattggatgctttttatggcaaagcctgaaggcagaatttacatagat
gacggagcaaaggatgcgctcctaaaaaggggaaaaagtcttcttcctgtgggaattaaa
aaggtagagggagaattcacaaggggagatacggtaagtatttttgatcttagaggggag
gaaattgcccgaggaataacaaattatgatagtttggaattagataagataaagggtaag
aataccgaggaaataagaaacattttaggggaagatttttacgaggaagtaattcacaga
aataatttagtattaaccaatagaggggacctttaa

DBGET integrated database retrieval system