KEGG   Dictyoglomus turgidum: Dtur_0841Help
Entry
Dtur_0841         CDS       T00800                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dtu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
863468..864952
Genome map
AA seq 494 aa AA seqDB search
MYILALDQGTTSSRAIIFDQLGNVISVAQKEFPQIFPKSGWVEHNPWDIWNSQREVMIEA
IEKAKIKPKEISTIGVTNQRETTIVWDKHTGQPIYNAIVWQCRRTADYCEELKRNGLSEV
IKEKTGLVIDAYFSGPKIKWILDNVPEAREKAEEGRLLFGTVDTWLIWNLTGGKVHATDY
TNASRTMLFNIKNLDWDDELLEIMNIPRSMLPKTFPSSYFYGVCNIFDGVEIPITGIAGD
QQAALFGQCGFEEGVVKNTYGTGCFILLNTGENIKYSSKGLITTIAYGIGEKVNYALEGS
IFIAGAVIQWLRDNLGLIKSSSESEILAKMVEDNGGVYFVPAFVGLGAPYWDMFARGLII
GLTRGAKKEHLVRAALESIAYQTNDVVELMEQETGIKIKELRVDGGASANNFLMQFQSDI
SNLKVIRPYITETTSLGAAFLAGLGVGIWKDLDEIKRIWKEEKVFTPCMPEEKRRYYLSK
WKEAVNRSRGWDKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtatattcttgccttggatcaaggtactacaagctcaagagctattatttttgaccaa
ttgggaaatgttataagtgtggctcaaaaggaatttcctcaaatttttccgaagtctggc
tgggtagaacacaatccatgggatatatggaattctcaaagggaagtaatgattgaggca
atagaaaaggcaaaaataaaacctaaagaaatttctactattggagttacaaaccaaagg
gaaactactattgtgtgggacaaacatacaggacaacccatatataatgctatagtctgg
caatgtagaagaactgcagattactgtgaagaattaaaaagaaatggactttcagaggtt
attaaagaaaaaactggacttgtcatagatgcgtatttctcaggtcctaagataaagtgg
attcttgataatgtacccgaggcaagagaaaaggctgaagaaggaagattgctttttggt
actgtggatacatggcttatatggaacttaacaggaggaaaagtgcatgctacagactat
actaatgcatccaggactatgttattcaacataaaaaatttagattgggatgatgaactt
ttggagataatgaatattccaagaagcatgcttcctaaaaccttcccctccagttatttt
tatggagtctgtaatatttttgatggtgtggagattcccataacaggaatagcgggtgat
cagcaggcagctttgtttggacagtgtggctttgaagaaggagttgtgaaaaacacctat
ggaacgggatgttttatccttcttaatacgggtgaaaatattaaatattcttcaaaggga
ttaataactactattgcttatggaattggagaaaaagttaactatgcattggagggtagt
atttttatagcaggagcggtaattcagtggctgagagataatcttggacttattaagagt
tcttcagaaagcgaaatcttagctaagatggttgaggataacggtggggtatattttgtt
ccagcctttgtagggcttggagcaccttattgggacatgtttgcaagaggtttaattatt
ggacttaccagaggggcaaagaaggaacatctggtgagagctgctttagaatccatagca
tatcaaactaatgatgtagtagagcttatggagcaagagacaggtattaaaataaaagaa
ttaagagtggatggaggtgcttcagcaaataattttctcatgcagtttcaatcagatatt
tctaatttaaaagttataagaccttatattactgaaactacctctcttggagcagctttt
ctcgcaggtcttggagtagggatatggaaagatcttgatgaaattaagagaatttggaaa
gaagaaaaggtatttactccttgtatgcctgaggaaaaaagaagatattatttatcaaaa
tggaaggaagctgtgaataggtctagaggttgggataaggaatga

DBGET integrated database retrieval system