KEGG   Dictyoglomus turgidum: Dtur_0841Help
Entry
Dtur_0841         CDS       T00800                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dtur_0841
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dtur_0841
Exosome [BR:dtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dtur_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
863468..864952
Genome map
AA seq 494 aa AA seqDB search
MYILALDQGTTSSRAIIFDQLGNVISVAQKEFPQIFPKSGWVEHNPWDIWNSQREVMIEA
IEKAKIKPKEISTIGVTNQRETTIVWDKHTGQPIYNAIVWQCRRTADYCEELKRNGLSEV
IKEKTGLVIDAYFSGPKIKWILDNVPEAREKAEEGRLLFGTVDTWLIWNLTGGKVHATDY
TNASRTMLFNIKNLDWDDELLEIMNIPRSMLPKTFPSSYFYGVCNIFDGVEIPITGIAGD
QQAALFGQCGFEEGVVKNTYGTGCFILLNTGENIKYSSKGLITTIAYGIGEKVNYALEGS
IFIAGAVIQWLRDNLGLIKSSSESEILAKMVEDNGGVYFVPAFVGLGAPYWDMFARGLII
GLTRGAKKEHLVRAALESIAYQTNDVVELMEQETGIKIKELRVDGGASANNFLMQFQSDI
SNLKVIRPYITETTSLGAAFLAGLGVGIWKDLDEIKRIWKEEKVFTPCMPEEKRRYYLSK
WKEAVNRSRGWDKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtatattcttgccttggatcaaggtactacaagctcaagagctattatttttgaccaa
ttgggaaatgttataagtgtggctcaaaaggaatttcctcaaatttttccgaagtctggc
tgggtagaacacaatccatgggatatatggaattctcaaagggaagtaatgattgaggca
atagaaaaggcaaaaataaaacctaaagaaatttctactattggagttacaaaccaaagg
gaaactactattgtgtgggacaaacatacaggacaacccatatataatgctatagtctgg
caatgtagaagaactgcagattactgtgaagaattaaaaagaaatggactttcagaggtt
attaaagaaaaaactggacttgtcatagatgcgtatttctcaggtcctaagataaagtgg
attcttgataatgtacccgaggcaagagaaaaggctgaagaaggaagattgctttttggt
actgtggatacatggcttatatggaacttaacaggaggaaaagtgcatgctacagactat
actaatgcatccaggactatgttattcaacataaaaaatttagattgggatgatgaactt
ttggagataatgaatattccaagaagcatgcttcctaaaaccttcccctccagttatttt
tatggagtctgtaatatttttgatggtgtggagattcccataacaggaatagcgggtgat
cagcaggcagctttgtttggacagtgtggctttgaagaaggagttgtgaaaaacacctat
ggaacgggatgttttatccttcttaatacgggtgaaaatattaaatattcttcaaaggga
ttaataactactattgcttatggaattggagaaaaagttaactatgcattggagggtagt
atttttatagcaggagcggtaattcagtggctgagagataatcttggacttattaagagt
tcttcagaaagcgaaatcttagctaagatggttgaggataacggtggggtatattttgtt
ccagcctttgtagggcttggagcaccttattgggacatgtttgcaagaggtttaattatt
ggacttaccagaggggcaaagaaggaacatctggtgagagctgctttagaatccatagca
tatcaaactaatgatgtagtagagcttatggagcaagagacaggtattaaaataaaagaa
ttaagagtggatggaggtgcttcagcaaataattttctcatgcagtttcaatcagatatt
tctaatttaaaagttataagaccttatattactgaaactacctctcttggagcagctttt
ctcgcaggtcttggagtagggatatggaaagatcttgatgaaattaagagaatttggaaa
gaagaaaaggtatttactccttgtatgcctgaggaaaaaagaagatattatttatcaaaa
tggaaggaagctgtgaataggtctagaggttgggataaggaatga

DBGET integrated database retrieval system