KEGG   Dictyoglomus turgidum: Dtur_1116Help
Entry
Dtur_1116         CDS       T00800                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtur_1116
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_1116
   00052 Galactose metabolism
    Dtur_1116
   00500 Starch and sucrose metabolism
    Dtur_1116
   00520 Amino sugar and nucleotide sugar metabolism
    Dtur_1116
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dtur_1116
   00524 Butirosin and neomycin biosynthesis
    Dtur_1116
Enzymes [BR:dtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dtur_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1135697..1136659
Genome map
AA seq 320 aa AA seqDB search
MRKAVGVDLGGTKINVLLVNEKGEVLGRDKQPTEADRGKDYVINKIKDMIHNVLQQGRVS
EKDIEGIGIGFPGLMDREKKSTLYAPNLGDEWKKEVFLGRELEEYFNVPTYLENDVNLIA
WAEWLVGAGRGTKTMICVALGTGIGSGIVLNGKLWIGAHGMAGEFGHITVLPDGPICGCG
NRGCIEAIASGTGIEKYARSILPQHTDSLIWGLCNGNLEEVTVKTIYQAAEQGDKLAIDI
FNHAGYYLGIALANYVHIVDPEKIVIGGGVANVREYIGKPMREEFYRRVLPSFRDKVTFS
WAELGEDAGGIGAALLALYR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaggctgtaggagtggatcttggaggaactaaaattaatgtacttcttgttaac
gagaagggagaggttttaggtagggataaacagcctactgaggcggataggggaaaagat
tatgttataaataagattaaggatatgattcataatgtattacagcaaggtagagtgagt
gaaaaggatattgaaggaataggaattggttttccaggtcttatggatagagaaaagaaa
tctactttgtatgctcctaatctgggggatgaatggaagaaagaagtttttctgggaaga
gaattagaagaatattttaatgttcctacttatttagagaatgatgttaaccttattgct
tgggcagaatggctcgtgggggcagggagaggtacaaaaactatgatctgtgtagctctt
ggaacaggcataggctcaggtatcgtacttaatgggaaattatggattggagctcatggg
atggcgggtgagtttgggcatatcacagtactccctgacggacctatttgtgggtgtgga
aatagagggtgtatagaagctatagcctctggaacaggcatagaaaaatatgcaagaagt
attctccctcaacatactgatagtttaatatggggcctttgcaatggtaatcttgaagag
gtaacagttaagactatttatcaggcggcagagcagggagataaattggctattgatatt
ttcaatcacgcagggtattatttaggaattgctcttgctaattacgtgcatattgtagat
ccagagaagattgtaattggtggaggagttgcaaatgtaagggaatatataggaaagccc
atgagagaagagttttataggagggttttgccaagttttagggataaagttactttttca
tgggcagagcttggagaagatgcaggtggtattggagcagcattattagctttgtatagg
tga

DBGET integrated database retrieval system