KEGG   Dictyoglomus turgidum: Dtur_1133Help
Entry
Dtur_1133         CDS       T00800                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtur_1133 (tpiA)
   01230 Biosynthesis of amino acids
    Dtur_1133 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_1133 (tpiA)
   00051 Fructose and mannose metabolism
    Dtur_1133 (tpiA)
   00562 Inositol phosphate metabolism
    Dtur_1133 (tpiA)
Enzymes [BR:dtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dtur_1133 (tpiA)
Exosome [BR:dtu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dtur_1133 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dtur_1133 (tpiA)
  Exosomal proteins of melanoma cells
   Dtur_1133 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1152030..1152779
Genome map
AA seq 249 aa AA seqDB search
MRRKIIAANWKMYKTCAETESFIKEFKELSKGYEEKEIVICPPFTSLYVANKLLEDTPIK
LGAQNMFWEKEGAYTGEISPIMLKDLNCSYVIIGHSERRQYFSETNDMINKKLKSAFEYE
LIPIFCVGEKWEEREKGKTEEVITEQVKKGLQGLEKEKVEKIVIAYEPVWAIGTGHSAKG
EDANEVAKLIRRIISEIYDEEVSQKVRIQYGGSVNPQNIKEFLAQSEIDGALVGGASLKP
QSFWDIVRS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaggaaaattattgctgctaactggaaaatgtataaaacttgtgcggaaactgag
agttttataaaagaatttaaagaactttcaaaaggttatgaggaaaaggagattgtaata
tgtccacctttcacatctttatatgtagcaaataagcttcttgaagacactcccattaag
cttggtgctcaaaatatgttttgggaaaaggaaggtgcatacacaggggaaatttctcct
ataatgcttaaggatttaaattgtagttatgtaataatagggcattcagagagaagacaa
tatttttctgagactaatgatatgataaacaaaaagcttaaatctgcatttgagtatgag
ctaatacccatattttgtgtgggagaaaaatgggaagagcgagaaaagggaaagacagag
gaagttattactgagcaagtaaagaagggattacaaggtttggaaaaagaaaaagtagaa
aaaattgtaatagcctatgagccagtttgggccataggaacaggtcattctgcaaaaggg
gaagatgctaatgaagtagcaaaactaataagaagaataatttctgaaatatatgatgaa
gaagtctctcaaaaggtgaggatacaatatggtggaagtgtaaatccccaaaacattaag
gaattcttagctcagagtgagattgatggggctttggttggtggagcgagtttaaaaccg
cagtctttttgggatatagttagaagttag

DBGET integrated database retrieval system